| Protein: 328782944 XP_395077.3 PREDICTED: pterin-4-alpha-carbinolamine dehydratase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.2 | 45 | 24.8 | 1.217742 | 1.8145162 |
| Scape | 29.4 | 41.2 | 29.4 | 1 | 1.4013605 |
| Brain | 57.5 | 42.5 | 1.3529412 | ||
| Crop | 44.2 | 55.8 | 0.7921147 | ||
| Eye | 55.3 | 44.7 | 1.2371365 | ||
| Intestine | 66.9 | 33.1 | 2.021148 | ||
| Leg, front | 66.5 | 33.5 | 1.9850746 | ||
| Leg, middle | 54.2 | 45.8 | 1.1834061 | ||
| Leg, rear | 80.6 | 19.4 | 4.1546392 | ||
| Mandibular gland | 51.5 | 48.5 | 1.0618557 | ||
| Rectum | |||||
| Salivary gland, cerebral | 90.3 | 9.7 | 9.3092785 | ||
| Salivary gland, thoracic | 36.4 | 22.6 | 40.9 | 0.88997555 | 0.55256724 |
| Sternite | 31.5 | 39.1 | 29.3 | 1.0750853 | 1.334471 |
| Tergite | 7.7 | 92.3 | 0.08342362 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.2 | 23.4 | 41.5 | 0.84819275 | 0.5638554 |
| Malpighian tubules | 34.2 | 33.1 | 32.6 | 1.0490798 | 1.0153375 |
| Nerve chord | 25.7 | 41.6 | 32.7 | 0.7859327 | 1.2721713 |
| Poison sac | |||||
| Sting | 68.3 | 31.7 | 2.1545742 | ||
| Heart | 17.6 | 45.8 | 36.7 | 0.47956404 | 1.2479564 |
| Hypopharyngeal gland | 54.1 | 45.9 | 1.1786492 | ||
| Galea | 42.5 | 34.3 | 23.2 | 1.8318965 | 1.4784483 |
| Glossa | 18.4 | 55.4 | 26.2 | 0.70229006 | 2.1145039 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39 | 46.7 | 37.3 | 1.0455765 | 1.2520107 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQDCVTGLLYQHLIGKLTQEEREKDLKPLLFNNWSVQQDRDAIYKEFLFKNFNQAFGFMT KVALQAEKMNHHPEWFNVYNKVNITLSSHDVNGLSQRDIKLASFIDNIAKMEEN |
 Top
| |