| Protein: 110750764 XP_001120137.1 PREDICTED: protein lethal(2)essential for life-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.4 | 60.6 | 0.650165 | ||
| Scape | 34.2 | 25 | 40.8 | 0.8382353 | 0.6127451 |
| Brain | |||||
| Crop | 30 | 70 | 0.42857143 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 60.1 | 39.9 | 1.5062656 | ||
| Leg, middle | 62.7 | 37.3 | 1.6809652 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 18.2 | 45.5 | 36.3 | 0.5013774 | 1.2534435 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 20.4 | 35.7 | 43.9 | 0.46469247 | 0.81321186 |
| Malpighian tubules | 35.2 | 10* | 54.8 | 0.6423358 | 0.18248175 |
| Nerve chord | 33.7 | 7.1 | 59.2 | 0.5692568 | 0.11993244 |
| Poison sac | 37.6 | 62.4 | 0.6025641 | ||
| Sting | |||||
| Heart | 32.1 | 67.9 | 0.47275406 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.1 | 28.8 | 52.1 | 0.7120921 | 0.55278313 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLIPMMFSDWWEDLDRPHRLWDQHFGTAIDLDDFNDLDSLGSEVLLYRPHKRGRRHHRH NHHPFLKAFNKRHGRGASIVQADKDKFQVTLDVSQFAPEEITVKVVDQKVVIEAKHEEKR DEHGWVSRQFVRKYIVPSQCDINQVESHLSSDGILSITAPRKEPLQSRSNERTVKVHYTG EPALTNFDDSSNDVSESQREQQIPQREQSQSQSQQNQQLQNQQHQQHQRCKKGSKGV |
 Top
| |