| Protein: 110755553 XP_396131.3 PREDICTED: aspartate aminotransferase mitochondrial isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.5 | 43.7 | 30.8 | 0.8279221 | 1.4188311 |
| Scape | 23 | 41.4 | 35.6 | 0.64606744 | 1.1629213 |
| Brain | 26 | 36.8 | 37.1 | 0.70080864 | 0.99191374 |
| Crop | 27.5 | 36.6 | 36 | 0.7638889 | 1.0166667 |
| Eye | 9.3 | 56.8 | 33.9 | 0.27433628 | 1.6755162 |
| Intestine | 34.1 | 27.9 | 38 | 0.89736843 | 0.73421055 |
| Leg, front | 30.8 | 40.5 | 28.7 | 1.0731708 | 1.4111499 |
| Leg, middle | 27.7 | 44.3 | 27.9 | 0.9928315 | 1.5878136 |
| Leg, rear | 44.8 | 32.6 | 22.6 | 1.9823009 | 1.4424778 |
| Mandibular gland | 49.2 | 50.8 | 0.96850395 | ||
| Rectum | 15.3 | 44.4 | 40.2 | 0.38059703 | 1.1044776 |
| Salivary gland, cerebral | 89.2 | 3.4 | 7.4 | 12.054054 | 0.45945945 |
| Salivary gland, thoracic | 37.8 | 22.7 | 39.5 | 0.95696205 | 0.57468355 |
| Sternite | 25.1 | 43.6 | 31.3 | 0.80191696 | 1.3929713 |
| Tergite | 11.9 | 67.5 | 20.7 | 0.5748792 | 3.2608695 |
| Ventriculus | 10.5 | 43.7 | 45.8 | 0.22925764 | 0.9541485 |
| Thoracic muscle | |||||
| Fat body | 29.4 | 31.5 | 39.1 | 0.75191814 | 0.8056266 |
| Malpighian tubules | 29.9 | 40 | 30.1 | 0.99335545 | 1.3289037 |
| Nerve chord | 23.9 | 46.7 | 29.4 | 0.81292516 | 1.5884354 |
| Poison sac | |||||
| Sting | 62.6 | 37.4 | 1.6737968 | ||
| Heart | 24.4 | 37.6 | 38 | 0.6421053 | 0.9894737 |
| Hypopharyngeal gland | 68.2 | 31.8 | 2.144654 | ||
| Galea | 46.5 | 32.3 | 21.2 | 2.1933963 | 1.523585 |
| Glossa | 35.4 | 35.4 | 29.1 | 1.2164948 | 1.2164948 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.8 | 40.9 | 32.6 | 0.9447853 | 1.2546012 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAQNKIKFAFSYNLFNKNKVALYGIRSMGTWWPHVKMGPPDAILGLTEAYKKDQNPNKVN LGVGAYRDDNGKPFVLPSVRKAEEKIKTKNMDKEYAPIAGSSDFCKQSIKLALGDNSDVV KNGLNATVQGVSGTGSLYIGSLFLSQFFSSNKEIYVPKPTWGNHSQIFRLAGLPMKFYRY YDPKTCGLDFNGALEDLSKIPGKSIVLFHACAHNPTGVDPNQDQWKELAETVKRRNLFPF FDMAYQGFASGSLENDAFAVRYFVKNGIDIMLAQSYAKNMGLYGERVGALSIITSNKEEA DRVLSQLKIIIRPAYSNPPINGARIVNEILEDSDLRKQWLIDVKTMADRIISMRQTLTDN LRKCGSTRDWSHITNQIGMFCFTGLKSSEAEKLIRDYSIYLTKDGRISVAGVTTKNVEYV AEAMHNVTK |
 Top
| |