| Protein: 110756965 XP_001120140.1 PREDICTED: protein NPC2 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.9* | 49.9* | 9.1 | 4.4945054 | 5.4835167 |
| Scape | 28.4 | 57.1* | 14.6 | 1.9452055 | 3.910959 |
| Brain | |||||
| Crop | 72.1* | 27.9 | 2.5842295 | ||
| Eye | |||||
| Intestine | 39.6* | 50* | 10.4 | 3.8076923 | 4.8076925 |
| Leg, front | 74.7 | 25.3 | 2.9525692 | ||
| Leg, middle | 78.9* | 21.1 | 3.7393365 | ||
| Leg, rear | 59.9 | 40.1 | 1.4937656 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 89.1* | 0.8* | 10.1 | 8.821782 | 0.07920792 |
| Sternite | 41.4 | 37.9 | 20.6 | 2.0097086 | 1.8398058 |
| Tergite | 21 | 79 | 0.2658228 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 24.6 | 75.4 | 0.32625994 | ||
| Malpighian tubules | |||||
| Nerve chord | 92.2* | 7.8 | 11.820513 | ||
| Poison sac | 50.5 | 49.5 | 1.020202 | ||
| Sting | |||||
| Heart | 19.3 | 57.3 | 23.5 | 0.8212766 | 2.438298 |
| Hypopharyngeal gland | |||||
| Galea | 0.5 | 98.4* | 1.1 | 0.45454547 | 89.454544 |
| Glossa | 12.4 | 47.6 | 40 | 0.31 | 1.19 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.5 | 56.8 | 28.5 | 1.1403508 | 1.9929825 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRGTILVFVALLVVVCATEVNHCGTGEKFEDPNQVKITGCDVPPCKLKRRTKASVEQKFV PKQDVESLVNSVNAAVLGVPLPFVGVDGTSACDNIYNLDGTPAGCSLKKDIEYIYKREFP VLQIYPTISMVIHYALMEGNNTIACFEVPAKITN |
 Top
| |