| Protein: 66514697 XP_392501.2 PREDICTED: muscle-specific protein 20 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 89* | 11 | 8.090909 | ||
| Scape | 29 | 49.9* | 21.1 | 1.3744075 | 2.364929 |
| Brain | |||||
| Crop | 74.7* | 6.8 | 18.5 | 4.037838 | 0.36756757 |
| Eye | 78.9* | 21.1 | 3.7393365 | ||
| Intestine | 37.8 | 42.8 | 19.4 | 1.9484537 | 2.2061856 |
| Leg, front | 21.3 | 44.4 | 34.3 | 0.62099123 | 1.2944607 |
| Leg, middle | 24.6 | 43.3 | 32.1 | 0.76635516 | 1.3489096 |
| Leg, rear | 16.6 | 46.9 | 36.5 | 0.45479453 | 1.2849315 |
| Mandibular gland | 15.5 | 61.1 | 23.4 | 0.66239315 | 2.6111112 |
| Rectum | 44.4 | 32.8 | 22.7 | 1.9559472 | 1.4449339 |
| Salivary gland, cerebral | 11.5 | 34.4 | 54.1 | 0.21256931 | 0.6358595 |
| Salivary gland, thoracic | 38.2 | 31.5 | 30.3 | 1.2607261 | 1.039604 |
| Sternite | 76.2* | 16.5 | 7.4 | 10.297297 | 2.2297297 |
| Tergite | 86.1* | 10.8 | 3.1 | 27.774193 | 3.483871 |
| Ventriculus | 55.1 | 44.9 | 1.2271715 | ||
| Thoracic muscle | |||||
| Fat body | 92.9* | 4.7 | 2.4 | 38.708332 | 1.9583334 |
| Malpighian tubules | 82.6* | 10.8 | 6.7 | 12.328359 | 1.6119403 |
| Nerve chord | 62.6* | 34.1* | 3.3 | 18.969696 | 10.333333 |
| Poison sac | |||||
| Sting | 44.2 | 55.8 | 0.7921147 | ||
| Heart | 63.2* | 17.4 | 19.4 | 3.257732 | 0.8969072 |
| Hypopharyngeal gland | 99.8* | 0.2 | 499 | ||
| Galea | 13.1 | 51.7 | 35.2 | 0.3721591 | 1.46875 |
| Glossa | 28.6 | 46.4 | 25 | 1.144 | 1.856 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.5 | 41.4 | 23 | 1.9782609 | 1.8 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALERQVRAKIAAKRNPEQEKEAQEWIESILDKKFPPGELFEDVIKDGQVLCHLMNKISP GSISKINSSGGQFKMMENINAFQKALKDYGVADVDVFQTVDLWEKKDIAQVVTTLFALGR TTYKHPEWKGPYLGPKPADECKREFTEEQLRAGQTVIGLQAGSNKGATQSGQSIGATRKI LLGK |
 Top
| |