| Protein: 328781423 XP_003249977.1 PREDICTED: hypothetical protein LOC409019 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.2 | 27.5 | 32.3 | 1.244582 | 0.85139316 |
| Scape | 35.8 | 64.2 | 0.5576324 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 59.3 | 40.7 | 1.4570024 | ||
| Leg, front | 31.2 | 32 | 36.8 | 0.84782606 | 0.8695652 |
| Leg, middle | 30.2 | 33.7 | 36.1 | 0.8365651 | 0.933518 |
| Leg, rear | 24.7 | 26.3 | 49 | 0.5040816 | 0.5367347 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 36.4 | 63.6 | 0.572327 | ||
| Sternite | 30.4 | 27.1 | 42.5 | 0.7152941 | 0.63764703 |
| Tergite | 60.1 | 39.9 | 1.5062656 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 50.9 | 49.1 | 1.0366598 | ||
| Hypopharyngeal gland | |||||
| Galea | 28.5 | 27.7 | 43.8 | 0.65068495 | 0.63242006 |
| Glossa | 42.5 | 57.5 | 0.73913044 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.1 | 34 | 46.3 | 0.82289416 | 0.73434126 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDQGFPAQHTTTTTVTTSTTTTQPNIRFDSSYIRTLPGILKIVQVVLNLLGFICITVSSY HTSRGEWFNTVAMGGFWFTGILLVFYLFHIVEKFSKIPWLKIEFLFCIIWTAFYLLAASL AVDYAKYVEAYGVAAFFGYCAMVVYGYDAWLKFQAIKNGALAQGQHTPKQVSTMTSPAY |
 Top
| |