| Protein: 328778083 XP_003249447.1 PREDICTED: delta(35)-Delta(24)-dienoyl-CoA isomerase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.9 | 38.2 | 29.9 | 1.0668896 | 1.277592 |
| Scape | 28.9 | 37.2 | 33.9 | 0.85250735 | 1.0973451 |
| Brain | 66.8 | 33.2 | 2.0120482 | ||
| Crop | 34.9 | 36.9 | 28.2 | 1.2375886 | 1.3085107 |
| Eye | |||||
| Intestine | 40.8 | 27.9 | 31.4 | 1.299363 | 0.888535 |
| Leg, front | 42.1* | 40 | 17.9 | 2.3519554 | 2.2346368 |
| Leg, middle | 35.5 | 42.4 | 22.1 | 1.6063348 | 1.918552 |
| Leg, rear | 38.3 | 38 | 23.7 | 1.6160338 | 1.6033756 |
| Mandibular gland | 8 | 92 | 0.08695652 | ||
| Rectum | 17.4 | 82.6 | 0.21065375 | ||
| Salivary gland, cerebral | 39.9 | 11.1 | 49 | 0.8142857 | 0.22653061 |
| Salivary gland, thoracic | 11.3 | 67.3 | 21.4 | 0.52803737 | 3.1448598 |
| Sternite | 9 | 75.6 | 15.4 | 0.58441556 | 4.909091 |
| Tergite | 65.8 | 34.2 | 1.9239767 | ||
| Ventriculus | |||||
| Thoracic muscle | 25.4 | 74.6 | 0.34048256 | ||
| Fat body | 5.5 | 53.1 | 41.4 | 0.13285024 | 1.2826087 |
| Malpighian tubules | 24.4 | 51.8 | 23.8 | 1.0252101 | 2.1764705 |
| Nerve chord | 27.7 | 49.5 | 22.8 | 1.2149123 | 2.1710527 |
| Poison sac | |||||
| Sting | 53.3 | 46.7 | 1.1413276 | ||
| Heart | 20.2 | 45.2 | 34.6 | 0.58381504 | 1.3063583 |
| Hypopharyngeal gland | 85 | 15 | 5.6666665 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26 | 49.2 | 36.8 | 0.70652175 | 1.3369565 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFLNTIRYCLKNIKAQTQYIYKMNYSNIKNFDKYKTLTISVPKEFVFMIQLNRSEKLNAL NDVMWKEFKICFNELATESECRVIILSGVGKAFCAGIDVENLMEFGQDLTKHKDIARKCK ILQLKIKEFQESFDAMEKCPKPVIAAVHGACIGAGVDMISAADIRYCSSDAWFQIKEVDF GMAADVGTLQRFSKIIGSDSLIRELVYTARKFSAVEAAQQGFVSCLFDNQESLLNGSIKL AEKIASKSPVAIQGSKLSLIYSRDHTVQEGLDHIAMYNQTMLLSEDFINAAMSQATKSDP PIFSKL |
 Top
| |