| Protein: 328794236 XP_001123234.2 PREDICTED: catalase-like partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.8 | 20.3* | 51 | 0.5647059 | 0.39803922 |
| Scape | 7.2* | 31 | 61.9 | 0.11631664 | 0.50080776 |
| Brain | |||||
| Crop | 43 | 20.1 | 36.9 | 1.1653117 | 0.54471546 |
| Eye | |||||
| Intestine | 48.1 | 19.6 | 32.3 | 1.4891641 | 0.60681117 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 14.5* | 85.5 | 0.16959064 | ||
| Mandibular gland | 36.2 | 63.8 | 0.56739813 | ||
| Rectum | 36.2 | 63.8 | 0.56739813 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.3 | 20.4 | 49.3 | 0.6146045 | 0.41379312 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 61.3 | 22.2 | 16.5 | 3.7151515 | 1.3454546 |
| Thoracic muscle | |||||
| Fat body | 7.5 | 4.8* | 87.6 | 0.08561644 | 0.05479452 |
| Malpighian tubules | 41.4 | 4.9* | 53.7 | 0.7709497 | 0.09124767 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 5.5* | 10.2* | 84.3 | 0.06524318 | 0.12099644 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.4 | 16.8 | 57.2 | 0.548951 | 0.2937063 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
DPRGFAVKFYTEEGVWDLVGNNTPIFFIKDPIYFPSFIHTQKRNPVTHLKDADMFWDFLS LRPESTHQVMFLFSDRGIPDGYRHMNGYGSHTFSLVNAKDEIVYCKFHYKTDQGIKNLPV DKAAELSASNPDYAIQDLYDAIAKNQYPTWTFYIQVMTPTQAKSFKWNPFDLTKVMD |
 Top
| |