| Protein: 328781606 XP_001120897.2 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 0.7* | 99.3 | 0.007049345 | ||
| Eye | |||||
| Intestine | 6.3* | 16.7* | 76.9 | 0.08192458 | 0.21716516 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 0.6* | 0.2* | 99.2 | 0.006048387 | 0.002016129 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 13.6 | 1.2* | 85.2 | 0.15962441 | 0.014084507 |
| Thoracic muscle | |||||
| Fat body | 5.6* | 5.4* | 89 | 0.062921345 | 0.060674157 |
| Malpighian tubules | 0.5* | 99.5 | 0.005025126 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 3.2 | 8.9* | 87.9 | 0.036405005 | 0.10125142 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 25.9 | 74.1 | 0.34952766 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 5 | 8.4 | 88.9 | 0.05624297 | 0.09448819 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLHFSLLKMVFLKFEMFLVIFILVLTLLYKKNGTFLYYFKYILYVGLSNIIVILVLPIFM FRPKNIHNLLIASYTCSWITKIVEIHWELRGKEHLEQDRGCIIVSNHQSAFDILGMYQIW PIMKKCTAIARRELFYVWPFGLAAWLAGLIFIDRRNAEKARLLINDTAKYVKEKKIKLWI YPEGTRRNTGEIHPFKKGAFYAAIHGQIPILPIVFSSYYFLSSKEKKFDSGRVIIKTLPA ISTEGMTIDDVNKLLEKTQNVMSETLRELNREIQSS |
 Top
| |