| Protein: 66507096 XP_397526.2 PREDICTED: reticulon-4 receptor-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 0.4* | 95.8* | 3.8 | 0.10526316 | 25.210526 |
| Scape | 1.3* | 91.3* | 7.4 | 0.17567568 | 12.337838 |
| Brain | 92.9* | 7.1 | 13.084507 | ||
| Crop | 81* | 19 | 4.263158 | ||
| Eye | 52.6 | 47.4 | 1.1097046 | ||
| Intestine | 97.8* | 2.2 | 44.454544 | ||
| Leg, front | 4.5 | 92.1* | 3.4 | 1.3235294 | 27.088236 |
| Leg, middle | 6.7 | 86* | 7.2 | 0.9305556 | 11.944445 |
| Leg, rear | 5.3 | 92.3* | 2.4 | 2.2083333 | 38.458332 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.8* | 36.9 | 62.2 | 0.012861736 | 0.5932476 |
| Sternite | 96.9* | 3.1 | 31.258064 | ||
| Tergite | 1.5* | 98.5 | 0.015228426 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 1.3* | 80* | 18.7 | 0.069518715 | 4.2780747 |
| Malpighian tubules | 62.9 | 37.1 | 1.6954178 | ||
| Nerve chord | 76.8 | 23.2 | 3.310345 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 2.8 | 92.2* | 5 | 0.56 | 18.44 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 14.2 | 73.5* | 12.3 | 1.1544715 | 5.97561 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 8.3 | 83.2 | 21.2 | 0.39150944 | 3.9245284 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRGSLIILATCFAACVAVCRPGLNGRNDWYRCEGLNEISESVLPFGAVGLSIVESNVSRI RSGSFAKLSESLEQLNVTGCGVETIEPAAFAGLGKLKVLGLVDNKIRSIDASWIRDVSRS LKALIVWRNRITEIDPEIYDLLTELEVWDIAHNELANCLQPEALKKLKKLGTILIAGNPW AYRCRFSMTWYLGKNHVRFIRDWGITDLLIEECLAHEPGAQQDDAILNECVDRKIGSSDS LPQSVAGLNEQVRELARKLRSLEADVATLKKSRI |
 Top
| |