| Protein: 66518230 XP_623818.1 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD+]-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 0.3* | 0.2* | 99.4 | 0.003018109 | 0.002012072 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 47.1 | 1.7* | 51.2 | 0.9199219 | 0.033203125 |
| Mandibular gland | 13.5 | 86.5 | 0.15606937 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 10.5 | 89.5 | 0.11731844 | ||
| Sternite | |||||
| Tergite | 2.7 | 5.6* | 91.7 | 0.02944384 | 0.061068702 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 1.9* | 1.2* | 96.9 | 0.019607844 | 0.012383901 |
| Malpighian tubules | |||||
| Nerve chord | 0.3* | 3.8* | 95.9 | 0.003128259 | 0.03962461 |
| Poison sac | 10.1 | 89.9 | 0.11234705 | ||
| Sting | 4.9* | 95.1 | 0.05152471 | ||
| Heart | 2.4* | 1* | 96.6 | 0.02484472 | 0.010351967 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 9.7 | 4.3 | 89.3 | 0.10862262 | 0.048152298 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTDNIKNKTALITGGTVGLGLIYAKRLLENGAKCVALLDLSSSPGQQTVNNLEKEFGKGK AIFYACDVSNINEFEAVFKKVVNDLNGLDIVINNAGIYNDKKWEQTMCINVGGVIQGSLL AFDHMSKLKGGKGGTIVNIASIVALDIIYSNPVYCASKHFVLAFSRSLARYYNNTGIRIL IMCPGVTTTSLLENPLSKSFDFVTQNDFYNCLGKDIPQTPEHVGNAMVKLIEKGKNEAVW VCKEGKQPYAVEFPPLKKIELQL |
 Top
| |