| Protein: 328792386 XP_001121759.2 PREDICTED: hypothetical protein LOC725976 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.9 | 49.1 | 1.0366598 | ||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 45.1 | 54.9 | 0.8214936 | ||
| Salivary gland, thoracic | 45.3 | 54.7 | 0.82815355 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.2 | 39.6 | 24.3 | 1.4897119 | 1.6296296 |
| Malpighian tubules | 4.5* | 73.3 | 22.1 | 0.20361991 | 3.3167422 |
| Nerve chord | 40.1 | 6.1 | 53.7 | 0.7467412 | 0.11359404 |
| Poison sac | |||||
| Sting | 27.1 | 72.9 | 0.3717421 | ||
| Heart | 7.6 | 66 | 26.4 | 0.28787878 | 2.5 |
| Hypopharyngeal gland | 37.9 | 62.1 | 0.61030596 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.8 | 41.7 | 46.7 | 0.70235544 | 0.8929336 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFWGLILEPNKRYTQTVEKSFHVSMASLNLSTADDNVVQVMLYYENSSYLLCNLKKSSTW QVPLDLNFQEGTTIAFICHGHGQVHLTGYLIPDEDLDLDEIEEEDEDEQVPQLLDKQSKR KATDSLKNEKNVKRLKQEIEAESSDEDIELDGVNEENDSDDSEEDEDSLLNEEETEEDEE DEEKNEQDEEEKKVKIQQKDKKNKQQQQKKREDKIIINGKEIKQEKNKGEQQQNEMNVQT DQKKRIVEGGVQIEELKIGNGSFAKNGKFVSVYYVGRLKNGKKFDATTHGDGFKFRLGKG EVIKGWDIGIAGMKVGGKRRITIPPAMAYGAKGSPPVIPGNSTLMFEVELRNVH |
 Top
| |