| Protein: 328790844 XP_003251474.1 PREDICTED: ras-related protein Rab-5B-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57.5 | 42.5 | 1.3529412 | ||
| Scape | 18.7 | 81.3 | 0.2300123 | ||
| Brain | 46.2 | 53.8 | 0.85873604 | ||
| Crop | 63.2 | 36.8 | 1.7173913 | ||
| Eye | |||||
| Intestine | 15* | 85 | 0.1764706 | ||
| Leg, front | 55.1 | 44.9 | 1.2271715 | ||
| Leg, middle | 50.9 | 49.1 | 1.0366598 | ||
| Leg, rear | 39.9 | 32.3 | 27.8 | 1.4352518 | 1.1618705 |
| Mandibular gland | 16.3 | 83.7 | 0.19474313 | ||
| Rectum | 49.4 | 19.2 | 31.4 | 1.5732484 | 0.611465 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 43.2 | 18.9 | 37.9 | 1.1398417 | 0.49868074 |
| Sternite | 54.4 | 45.6 | 1.1929824 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.4 | 35.3 | 28.3 | 1.2862191 | 1.2473499 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 34.1 | 41.6 | 24.2 | 1.4090909 | 1.7190082 |
| Hypopharyngeal gland | 72.1 | 27.9 | 2.5842295 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.6 | 39.4 | 46.7 | 0.86937904 | 0.84368306 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MANRGTAQRPNGSTQGKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFVRAQTWVKELQR QASPSIVIALAGNKADLANKRIVEFDEAQTYADENGLLFMETSAKTAMNVNDIFLAIGKI ILMNNQEVQVQVVKAVDWLKQKDKRQQLAIVASDYPNLSVL |
 Top
| |