| Protein: 66548968 XP_625104.1 PREDICTED: 40S ribosomal protein S18 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.8 | 54.2 | 0.84501845 | ||
| Scape | 34.8 | 37.2 | 28 | 1.2428571 | 1.3285714 |
| Brain | |||||
| Crop | 19.3 | 42.5 | 38.2 | 0.5052356 | 1.1125654 |
| Eye | 61.6 | 38.4 | 1.6041666 | ||
| Intestine | 11.1 | 56.4 | 32.6 | 0.3404908 | 1.7300613 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 71.7 | 4.8 | 23.6 | 3.0381355 | 0.20338984 |
| Salivary gland, thoracic | 36.1 | 18.4 | 45.5 | 0.7934066 | 0.4043956 |
| Sternite | 10.9 | 59.3 | 29.8 | 0.3657718 | 1.9899329 |
| Tergite | 37.3 | 53.9 | 8.8 | 4.2386365 | 6.125 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35 | 36.4 | 28.6 | 1.2237762 | 1.2727273 |
| Malpighian tubules | 39.1 | 21.3 | 39.6 | 0.9873737 | 0.5378788 |
| Nerve chord | 46.5 | 7.1 | 46.4 | 1.0021552 | 0.15301724 |
| Poison sac | |||||
| Sting | 50.9 | 49.1 | 1.0366598 | ||
| Heart | 21 | 48.2 | 30.9 | 0.6796116 | 1.5598706 |
| Hypopharyngeal gland | 18.2 | 81.8 | 0.22249389 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 37.5 | 38.4 | 0.859375 | 0.9765625 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLVIPEKFQHILRVMGTNIDGNRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECS EEEVEKIVTIMANPRQYKIPDWFLNRQKDIVDGKYSQLTSSYLDSKLREDLERMKKIRAH RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK |
 Top
| |