| Protein: 110755333 XP_001121817.1 PREDICTED: cytochrome c oxidase subunit 6A1 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.1 | 34.7 | 33.2 | 0.96686745 | 1.0451807 |
| Scape | 53.3 | 19.1 | 27.7 | 1.9241878 | 0.6895307 |
| Brain | 50.2 | 49.8 | 1.0080321 | ||
| Crop | 35.6 | 27.9 | 36.5 | 0.97534245 | 0.76438355 |
| Eye | 72.6 | 9.9 | 17.5 | 4.1485715 | 0.5657143 |
| Intestine | 13 | 30.4 | 56.7 | 0.2292769 | 0.5361552 |
| Leg, front | 10.3* | 39.2 | 50.5 | 0.20396039 | 0.7762376 |
| Leg, middle | 38 | 41.3 | 20.7 | 1.8357488 | 1.995169 |
| Leg, rear | 25.2 | 29.4 | 45.3 | 0.5562914 | 0.6490066 |
| Mandibular gland | 37.6 | 2.8 | 59.7 | 0.62981576 | 0.046901174 |
| Rectum | 74.7 | 25.3 | 2.9525692 | ||
| Salivary gland, cerebral | 37.1 | 24.8 | 38.1 | 0.9737533 | 0.65091866 |
| Salivary gland, thoracic | 17.2 | 59.9 | 22.9 | 0.7510917 | 2.6157205 |
| Sternite | 22 | 34.7 | 43.3 | 0.50808316 | 0.8013857 |
| Tergite | 30.1 | 30.4 | 39.5 | 0.7620253 | 0.76962024 |
| Ventriculus | |||||
| Thoracic muscle | 51.1 | 23.6 | 25.2 | 2.0277777 | 0.93650794 |
| Fat body | 25.1 | 55.6 | 19.3 | 1.3005182 | 2.880829 |
| Malpighian tubules | 35.3 | 42.4 | 22.3 | 1.5829597 | 1.9013453 |
| Nerve chord | 38.5 | 24.7 | 36.8 | 1.0461956 | 0.6711956 |
| Poison sac | |||||
| Sting | 29.7 | 70.3 | 0.4224751 | ||
| Heart | 47.3 | 21.2 | 31.5 | 1.5015873 | 0.6730159 |
| Hypopharyngeal gland | 84.6 | 15.4 | 5.4935064 | ||
| Galea | 42.9 | 30.9 | 26.2 | 1.6374046 | 1.1793894 |
| Glossa | 49.2 | 12 | 38.8 | 1.2680413 | 0.30927834 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.7 | 34.8 | 35.5 | 1.0056338 | 0.9802817 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MARILKLGQFGHTFTRGMEEYVKTVEQRTHHISEGSIKLWKSITFFVAFPIIGLAMANCY LKHQEEHSKPPPEFVHYPYLKIMNKPFPWGDGKHTLFHNPRINYIPGIGYEEHH |
 Top
| |