![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328785048 XP_393056.2 PREDICTED: succinate dehydrogenase cytochrome b560 subunit mitochondrial |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 78.5* | 21.5 | 3.6511629 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 31.9 | 68.1 | 0.4684288 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 28.4 | 44.3 | 27.3 | 1.0402931 | 1.6227106 |
| Sternite | 32.7 | 15.8 | 51.5 | 0.6349515 | 0.3067961 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 58.7 | 41.3 | 1.4213076 | ||
| Fat body | 34.7 | 39.3 | 26 | 1.3346153 | 1.5115385 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 19.9 | 45.2 | 34.9 | 0.57020056 | 1.295129 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 45 | 55 | 0.8181818 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 42.9 | 40.7 | 0.8574939 | 1.054054 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALCYMRLLSRRCIDPCTFRNFYTCSSRNIAVSKPLFKETTICETHDEKNLRLKRPLSPH LTIYQIQLTAFLSITHRTTGMILSSYAMLFGIGTLLIPGGKTLLALPATYHTFNGLRHLA WDLGMFLTIKEVYSTGYAVIALSAISAIALAAL |
|
| |