| Protein: 48138741 XP_393421.1 PREDICTED: putative ATP synthase subunit f mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.3 | 27.2 | 40.4 | 0.79950494 | 0.6732673 |
| Scape | 29.3 | 26.8 | 43.9 | 0.667426 | 0.61047834 |
| Brain | |||||
| Crop | 32.9 | 34.2 | 32.8 | 1.0030488 | 1.0426829 |
| Eye | 29.2 | 70.8 | 0.4124294 | ||
| Intestine | 40.5 | 59.5 | 0.6806723 | ||
| Leg, front | 27.2 | 25.2 | 47.6 | 0.5714286 | 0.5294118 |
| Leg, middle | 33.4 | 29.4 | 37.2 | 0.89784944 | 0.7903226 |
| Leg, rear | 28.1 | 27.9 | 44 | 0.63863635 | 0.6340909 |
| Mandibular gland | 57 | 43 | 1.3255814 | ||
| Rectum | |||||
| Salivary gland, cerebral | 49.4 | 20.4 | 30.2 | 1.6357616 | 0.6754967 |
| Salivary gland, thoracic | 30.3 | 39.6 | 30.1 | 1.0066445 | 1.3156146 |
| Sternite | 36.5 | 39.7 | 23.8 | 1.5336134 | 1.6680672 |
| Tergite | 34.2 | 36.4 | 29.4 | 1.1632653 | 1.2380953 |
| Ventriculus | |||||
| Thoracic muscle | 28.4 | 52.4 | 19.3 | 1.4715025 | 2.715026 |
| Fat body | 27.2 | 47.3 | 25.6 | 1.0625 | 1.8476562 |
| Malpighian tubules | 35.7 | 36.8 | 27.5 | 1.2981818 | 1.3381819 |
| Nerve chord | 25.1 | 37 | 38 | 0.66052634 | 0.9736842 |
| Poison sac | |||||
| Sting | 44 | 56 | 0.78571427 | ||
| Heart | 40.6 | 27.7 | 31.6 | 1.2848102 | 0.87658226 |
| Hypopharyngeal gland | 80.8 | 19.2 | 4.2083335 | ||
| Galea | 29.3 | 41.6 | 29.1 | 1.0068729 | 1.4295533 |
| Glossa | 40.5 | 16 | 43.5 | 0.9310345 | 0.3678161 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.3 | 36.2 | 37.4 | 0.9171123 | 0.96791446 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTIKENKLTELIKFKTWGCYPEGYNPAEHGPYDPSRYYGKPDTPFGEVKLGELPAWFSRR EKGFRAFAALISRAHWRWQLKYIHPRKANMAPLYQAAFLASAFGYCINYLRLRGHRNYKY H |
 Top
| |