| Protein: 328790797 XP_003251463.1 PREDICTED: actin clone 205-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.7 | 31.9 | 36.3 | 0.87327826 | 0.8787879 |
| Scape | 45.9 | 34.9 | 19.2 | 2.390625 | 1.8177084 |
| Brain | 35.5 | 31.6 | 32.9 | 1.0790274 | 0.9604863 |
| Crop | 30.3 | 17.7 | 52 | 0.5826923 | 0.3403846 |
| Eye | 7.7 | 52 | 40.3 | 0.191067 | 1.2903225 |
| Intestine | 36.8 | 31.5 | 31.6 | 1.164557 | 0.9968355 |
| Leg, front | 27.7 | 42.3 | 30 | 0.92333335 | 1.41 |
| Leg, middle | 26.1 | 42.3 | 31.5 | 0.82857144 | 1.3428571 |
| Leg, rear | 34.7 | 44.9 | 20.4 | 1.7009804 | 2.2009804 |
| Mandibular gland | 66.9 | 7.2 | 26 | 2.573077 | 0.2769231 |
| Rectum | 34.4 | 14.7 | 51 | 0.6745098 | 0.2882353 |
| Salivary gland, cerebral | 8.6 | 33.1 | 58.3 | 0.14751287 | 0.567753 |
| Salivary gland, thoracic | 46.7 | 21.4 | 31.9 | 1.4639498 | 0.6708464 |
| Sternite | 53.1 | 17.6 | 29.3 | 1.8122867 | 0.6006826 |
| Tergite | 32.6 | 26.9 | 40.5 | 0.80493826 | 0.6641975 |
| Ventriculus | 18.9 | 31.4 | 49.7 | 0.3802817 | 0.63179076 |
| Thoracic muscle | 49.9 | 50.1 | 0.996008 | ||
| Fat body | 88.1* | 7.6 | 4.3 | 20.488373 | 1.7674419 |
| Malpighian tubules | 37.7 | 29.4 | 32.9 | 1.1458967 | 0.89361703 |
| Nerve chord | 37.7 | 30.8 | 31.5 | 1.1968254 | 0.9777778 |
| Poison sac | 63.9 | 36.1 | 1.7700831 | ||
| Sting | 50.1 | 49.9 | 1.004008 | ||
| Heart | 27.3 | 39.6 | 33.1 | 0.82477343 | 1.1963747 |
| Hypopharyngeal gland | 81.5 | 18.5 | 4.4054055 | ||
| Galea | 34.5 | 23.6 | 41.9 | 0.823389 | 0.56324583 |
| Glossa | 45.6 | 21.1 | 33.4 | 1.3652694 | 0.6317365 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.3 | 33.2 | 35.1 | 1.0626781 | 0.94586897 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKS YELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANNVL SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK QEYDESGPGIVHRKCF |
 Top
| |