| Protein: 328775835 XP_001122920.2 PREDICTED: single-stranded DNA-binding protein mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.5 | 45.5 | 1.1978022 | ||
| Scape | |||||
| Brain | |||||
| Crop | 40.1 | 59.9 | 0.6694491 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 50.7 | 49.3 | 1.0283976 | ||
| Salivary gland, thoracic | 52.7 | 12.9 | 34.4 | 1.5319767 | 0.375 |
| Sternite | 49.7 | 50.3 | 0.98807156 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 70 | 30 | 2.3333333 | ||
| Malpighian tubules | 30.8 | 28.3 | 40.9 | 0.7530562 | 0.69193155 |
| Nerve chord | 54.3 | 11.5 | 34.1 | 1.5923754 | 0.3372434 |
| Poison sac | |||||
| Sting | |||||
| Heart | 36 | 31.1 | 32.9 | 1.0942249 | 0.9452888 |
| Hypopharyngeal gland | 79.8 | 20.2 | 3.950495 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.4 | 42.9 | 39.8 | 1.0904523 | 1.0778894 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFRQVIPQMIRNSRTIKNIQTSTDIDVNMKLEKSINQVTLLGRVGGEAQKKGSNEHPVVI FSLATHNNYKYTNGDIVQRTDWHKICVFKPNLRENVYTYLKKGQRVLVSGKISYGEYKDE EGAIKSTTAVIADDVIFFHHNN |
 Top
| |