| Protein: 110758628 XP_392556.3 PREDICTED: transmembrane emp24 domain-containing protein bai |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.9 | 45.1 | 1.2172949 | ||
| Scape | 38.1 | 27.4 | 34.5 | 1.1043478 | 0.7942029 |
| Brain | 42 | 58 | 0.7241379 | ||
| Crop | 35.2 | 33.8 | 31 | 1.1354839 | 1.0903226 |
| Eye | |||||
| Intestine | 24.9 | 39.3 | 35.8 | 0.6955307 | 1.0977653 |
| Leg, front | 45.2* | 36.1 | 18.7 | 2.4171124 | 1.9304813 |
| Leg, middle | 65.4 | 34.6 | 1.8901734 | ||
| Leg, rear | 51.6 | 48.4 | 1.0661157 | ||
| Mandibular gland | |||||
| Rectum | 33.4 | 66.6 | 0.5015015 | ||
| Salivary gland, cerebral | 85.6 | 14.4 | 5.9444447 | ||
| Salivary gland, thoracic | 33.2 | 34.4 | 32.5 | 1.0215385 | 1.0584615 |
| Sternite | 13.6 | 41.8 | 44.6 | 0.30493274 | 0.93721974 |
| Tergite | 19.1 | 44.8 | 36.1 | 0.5290859 | 1.2409972 |
| Ventriculus | 36 | 43.3 | 20.8 | 1.7307693 | 2.0817308 |
| Thoracic muscle | |||||
| Fat body | 26.9 | 37.5 | 35.5 | 0.75774646 | 1.0563381 |
| Malpighian tubules | 24 | 57 | 19 | 1.2631578 | 3 |
| Nerve chord | 76.8* | 23.2 | 3.310345 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 12.9 | 56.5 | 30.6 | 0.42156863 | 1.8464053 |
| Hypopharyngeal gland | 14.6 | 85.4 | 0.17096019 | ||
| Galea | 39.5 | 20.1 | 40.4 | 0.97772276 | 0.49752474 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.3 | 39.6 | 37.8 | 1.0132275 | 1.0476191 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRIIIFIFAMLFAYVHSIRFYLEPNSMKCLKEEVQANVLLAGEYEVSLAPAVKTEYVVKD SKGDILSKKDDIPHGKILKFSFVTETYDTFEICFMAHAIQPSFSGNIKQIKQEIYLITKR GIEAKNYEGIGEAAKLKPSEVELKRLEDLSEAIVQDFARMRKNEEEMRDTNEATNTRVLY FSIFSMCWLLGLSIWQVLYLRRFFKAKKLIE |
 Top
| |