| Protein: 66549336 XP_623227.1 PREDICTED: small ubiquitin-related modifier 3 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.6 | 29.5 | 33.9 | 1.079646 | 0.8702065 |
| Scape | 51.8 | 48.2 | 1.0746888 | ||
| Brain | 43 | 57 | 0.75438595 | ||
| Crop | 26.4 | 73.6 | 0.35869566 | ||
| Eye | |||||
| Intestine | 42.7 | 57.3 | 0.7452007 | ||
| Leg, front | 35.8 | 38.8 | 25.4 | 1.4094489 | 1.527559 |
| Leg, middle | 28.4 | 41.9 | 29.6 | 0.9594595 | 1.4155406 |
| Leg, rear | 52.7 | 47.3 | 1.114165 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 61.4 | 38.6 | 1.5906736 | ||
| Sternite | 19.4 | 46.5 | 34.1 | 0.56891495 | 1.3636364 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 45.7 | 54.3 | 0.8416206 | ||
| Nerve chord | 53.3 | 46.7 | 1.1413276 | ||
| Poison sac | |||||
| Sting | 63 | 37 | 1.7027028 | ||
| Heart | 25.1 | 39.8 | 35.2 | 0.7130682 | 1.1306819 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 64 | 36 | 1.7777778 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.1 | 45.1 | 43.6 | 0.8738532 | 1.0344037 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDEKKETKTESEHINLKVLGQDSAVVQFKIKKHTPLRKLMNAYCDRVGLAIAAVRFRFD GQPINELDTPTTLEMEEGDTIEVYQQQTGGGLC |
 Top
| |