![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328781218 XP_392535.3 PREDICTED: beta-arrestin-1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 37.5 | 7.6 | 54.8 | 0.68430656 | 0.13868614 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 70 | 30 | 2.3333333 | ||
| Malpighian tubules | 27 | 44 | 29 | 0.9310345 | 1.5172414 |
| Nerve chord | 39.4 | 32.6 | 28 | 1.4071429 | 1.1642857 |
| Poison sac | |||||
| Sting | |||||
| Heart | 5.8 | 55.3 | 38.9 | 0.14910026 | 1.4215938 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.5 | 41.9 | 36.1 | 0.7617729 | 1.1606648 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAKWDSSESEYSEPEESNELGAIVSPEICAMDTVDSASKRQATRVFKKSSLNGKITVYLG KRDFVDHITHVDPIDGVVLIDPDYAKDRKVFGHVLAAFKYGREDLDVLGLTFRKDLYLAA EQIYPVVAGAQQRKLTRLQEKLIKKLGSNAYPFYFELPPHCPASVTLQPAPGDTGKPCGV DYELKAFVGETQDDKPQKRNSVRLAIRKIMYAPSKQGEQPSVEVSKEFVMSPNKLHLEAS LDKELYHHGENIAVNVHIANNSNRTVKKIKVSVRQFADICLFSTAQYKCTVAEAESDIGV SPGFTLSKVFSLRPTLADNKDKRGLALDGQLKHEDTNLASSTIVVDPSQRENLGIIVQYK VKVKLCLGALGGELVAELPFILMHPKPEEEEPAPPTARPSPTQKTDSEIPLDTNLIQLDT EADGDDDIIFEDFARLRLKGETDA |
|
| |