| Protein: 328787790 XP_624806.3 PREDICTED: peroxiredoxin-5 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.8 | 53.2 | 0.87969923 | ||
| Scape | 31 | 32.6 | 36.3 | 0.8539945 | 0.89807165 |
| Brain | 57.3 | 42.7 | 1.3419204 | ||
| Crop | 30.8 | 31 | 38.2 | 0.8062827 | 0.8115183 |
| Eye | 46.3 | 53.7 | 0.8621974 | ||
| Intestine | 34.5 | 32.9 | 32.6 | 1.0582823 | 1.0092025 |
| Leg, front | 39.3 | 24.6 | 36.1 | 1.0886427 | 0.6814405 |
| Leg, middle | 29.4 | 28.9 | 41.8 | 0.7033493 | 0.69138753 |
| Leg, rear | 41.7 | 33.6 | 24.8 | 1.6814516 | 1.3548387 |
| Mandibular gland | 8.9 | 33.3 | 57.8 | 0.15397924 | 0.57612455 |
| Rectum | 6.1 | 14.3 | 79.6 | 0.07663316 | 0.17964824 |
| Salivary gland, cerebral | 44.7 | 31.3 | 24 | 1.8625 | 1.3041667 |
| Salivary gland, thoracic | 38.9 | 28.8 | 32.3 | 1.2043344 | 0.89164084 |
| Sternite | 43.9 | 34.1 | 21.9 | 2.0045662 | 1.5570776 |
| Tergite | 46.1 | 30.4 | 23.5 | 1.9617021 | 1.293617 |
| Ventriculus | 16.3 | 36.2 | 47.5 | 0.3431579 | 0.7621053 |
| Thoracic muscle | 9.5 | 90.5 | 0.10497238 | ||
| Fat body | 36.5 | 29 | 34.5 | 1.057971 | 0.8405797 |
| Malpighian tubules | 33.4 | 40.9 | 25.7 | 1.2996109 | 1.5914397 |
| Nerve chord | 24.4 | 33.8 | 41.8 | 0.58373207 | 0.80861247 |
| Poison sac | |||||
| Sting | 45.2 | 54.8 | 0.82481754 | ||
| Heart | 37.3 | 25.5 | 37.2 | 1.0026882 | 0.6854839 |
| Hypopharyngeal gland | 81.4 | 18.6 | 4.376344 | ||
| Galea | 31.8 | 37.5 | 30.7 | 1.0358306 | 1.2214984 |
| Glossa | 22.7 | 42.4 | 34.9 | 0.6504298 | 1.2148997 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.1 | 36.1 | 40.6 | 0.76600987 | 0.88916254 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNPLINRTIFFSGRHSFGYFIRQFRISSQNMVTVGEKIPTIDLFEDSPTNKVNLAKISNG KKIIVFGVPGAFTPGCSKTHLPGYIQKASDLKSKGISEIFCISVNDPFVMAAWGKAQGAE GKVRMLADPAAQFTDALELSVDLPVLGGKRSKRYSMVLDNGIITELNIEPDNTGLSCSLV ENIKV |
 Top
| |