| Protein: 328786824 XP_623788.2 PREDICTED: alpha-tocopherol transfer protein-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.6 | 51.4 | 0.9455253 | ||
| Scape | 23.4 | 25.9 | 50.7 | 0.46153846 | 0.5108481 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 1.4* | 70.9 | 27.7 | 0.050541516 | 2.5595667 |
| Leg, front | 22.5* | 9* | 68.6 | 0.32798833 | 0.13119534 |
| Leg, middle | 25.4 | 9.7* | 64.8 | 0.3919753 | 0.14969136 |
| Leg, rear | 18.9 | 17.3 | 63.8 | 0.29623824 | 0.2711599 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 77.6 | 7.3 | 15.1 | 5.139073 | 0.4834437 |
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 74.3 | 25.7 | 2.8910506 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 10.3 | 24.5 | 65.2 | 0.15797547 | 0.37576687 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 40.5 | 59.5 | 0.6806723 | ||
| Heart | 4.3 | 49.1 | 46.6 | 0.09227468 | 1.0536481 |
| Hypopharyngeal gland | 98.6* | 1.4 | 70.42857 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23 | 39.6 | 45.1 | 0.5099778 | 0.8780488 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEVERTTLTEWDKIPSIKVGDFTLEVEFGPPCKELQEIAKNELRETPELQQDAIARLREL LKAETNLKCPVENDAWLVRFLRPCKYYPESALNLVKNYYNFKVKHSNVYENLKPSKEKNI FEQNILSVLPNRDQNGRRILLIELGKKWKHNKCSLDEVFKGCVLYVEAAMLEPATQIAGA IVIFDMDGLTLQQAWQFTPAFAKRIVDWLQDAVPLRIKNIHVVNQPYVFNMVFALFKPFL RDKLKNRLIFHGTDRKSLHQYISPKCLPACYGGNLQLPRITGTQWLELLLLCDKEYDAIN SYGYKK |
 Top
| |