| Protein: 328785105 XP_392797.3 PREDICTED: phosphatidylinositol-5-phosphate 4-kinase type-2 alpha-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 28.3 | 27.1 | 44.5 | 0.63595504 | 0.60898876 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 46.3 | 20.6 | 33.1 | 1.3987916 | 0.6223565 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 71.4 | 28.6 | 2.4965036 | ||
| Malpighian tubules | 36 | 41.6 | 22.4 | 1.6071428 | 1.8571428 |
| Nerve chord | 28.1 | 29.7 | 42.2 | 0.6658768 | 0.70379144 |
| Poison sac | |||||
| Sting | |||||
| Heart | 53.3 | 22.6 | 24.1 | 2.2116182 | 0.93775934 |
| Hypopharyngeal gland | 53.7 | 46.3 | 1.1598272 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.4 | 38.1 | 34.5 | 1.1130434 | 1.1043478 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSVPQMSSGLSKLKKKHFRVKHQKVKLFRANEPLLSVFMWGVNHTINELSHVNIPVVLL PDDFRAYSKLKVDYHFFNKENMPSHFTFKEYCPLVFRNLRERFGIDDLDYKESMTRSQPI LEDSSGKSGAKFYQSYDKLFIIKTLTGEEVERMNSFLKHYHPYIVERHGKTLLPQYLGMY RLTVDGVEHYVVAIRNVFSNHLTTHKKFDLKGSTVDREASDKEKEKDLPTYKDNDFVKEG MKIYIGEEAKTKLIETLTADVDFLTKLHLMDYSLLLGLHDCARAEQENRERAEKEEEEDN HEEEDDSESGSGLDSRGPMGDRLWGWSGVAGMTTPPESPHAALMRDTSLQYEDAIIPELD IYAIPSKEGAPTKEIYFLAIIDVLTHYGVRKQAAKAAKTVKYGANVDGISTCDPEQYGKR FIEFMSKAIE |
 Top
| |