![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66526670 XP_624161.1 PREDICTED: methionine aminopeptidase 2 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 45.5 | 30.1 | 24.4 | 1.8647541 | 1.2336066 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35 | 36.5 | 28.5 | 1.2280701 | 1.2807018 |
| Malpighian tubules | 47.7 | 52.3 | 0.9120459 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 10.1 | 36.6 | 53.3 | 0.18949343 | 0.6866792 |
| Hypopharyngeal gland | 46 | 54 | 0.8518519 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.6 | 37.3 | 42.5 | 0.81411767 | 0.87764704 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAVLDEVGKSAEKLVNEEKDEIVDEEDETGAVEASKKKKKKKKKKKAGAGEASADVPEG EEEKTKNDNAIDEEVDIEATENDAETEDIKKKKKKRKSRGKGPKQQTDPPTIPVSELFSD GNFPIGQIMDHPPAAGIDDRTAKERFSSEEARAFDRMHNDIYNEARQAAEAHRQTRKHIM KWVKPGMTMIEICNELENTARKLIGEDGLKAGLAFPTGCSRNHCAAHYTPNAGDPTVLEY DDVTKIDFGTHINGRIIDCAFTLAFNPKYDKLIEAVRDATNTGIKAAGIDVQLCDVGAAI QEVMESYEIELDGKTYPVKSIRNLNGHSIAPYRIHAGKTVPIVKGGEATRMEENEFYAIE TFGSTGRGIVHDDLDCSHYMKSFDAGFVPLRLQSSKSLLNVINKHFGTLAFCKRWLDRVG CTKYQMALKDLCDKGAVEAYPPLVDVKGCYTAQFEHTLVLRPTCKEVISRGDDY |
|
| |