![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328784987 XP_623652.2 PREDICTED: serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 13.1* | 6.4* | 80.5 | 0.16273291 | 0.079503104 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 52.4 | 47.6 | 1.1008403 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 49 | 51 | 0.9607843 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.8 | 66.2 | 0.51057404 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 18.1 | 81.9 | 0.22100122 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 13.1 | 48.6 | 38.3 | 0.34203655 | 1.2689295 |
| Hypopharyngeal gland | 71.1 | 28.9 | 2.4602077 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.3 | 42.5 | 56.3 | 0.41385436 | 0.75488454 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSSSSTRNATSSGWMQSSLVASNAEKVQPRHESASSVPLPSSSYSASANPNMSSATFVD RIDPFAKRSLKKKSKKSQGSSRYRNSQDVELQQLPQLKDVTPSEQEDLFIRKLRQCCVTF DFMDPMADLKGKEIKRSTLNELVEYITAGRGVLTEPVYPEIIKMISANLFRTLPPSETPD FDPEEDDPTLEASWPHLQLVYEFFLRFLESSDFQPTIGKKVIDQKFVLQLLELFDSEDPR ERDFLKTVLHRIYGKFLGLRAFIRKQISNIFLRFVYETEHFNGVGELLEILGSIINGFAL PLKVEHKQFLVKVLLPLHKVKCLSLYHAQLAYCVVQFLEKDATLTEPVIRGLLKFWPKTC SQKEVMFLGEIEEILDVIEPSQFVKIQEPLFRQIARCVSSPHFQVAERALFFWNNEYIMS LIEENNHVIMGIMFPALYRISKEHWNQTIIALVYNVLKTFMEMNSKLFDELTASYKSERQ KEKKREKERDELWRKLTELEVERRNALTATFNNPVPATTPTTRARP |
|
| |