| Protein: 66524764 XP_623518.1 PREDICTED: proline synthase co-transcribed bacterial homolog protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 33.3 | 66.7 | 0.49925038 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 6.8* | 5.3* | 87.9 | 0.07736064 | 0.06029579 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.8 | 34.6 | 34.5 | 0.8927536 | 1.0028986 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.5 | 42.2 | 35.3 | 0.6373938 | 1.1954675 |
| Malpighian tubules | 18.3 | 45.8 | 36 | 0.5083333 | 1.2722223 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 26.2 | 40.5 | 33.3 | 0.7867868 | 1.2162162 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23 | 33.7 | 49 | 0.46938777 | 0.6877551 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAELIANLKLVKNKITIASARRSPEYKYFEPRLVAVSKLKPVELIVDAYKAGQRHFGENY VNELLEKGNDPIILETCTNIHWHFIGHLQRNKVNKLLSVPNLYVIESIDNEKLASAVNTS WINYRKDENLKLKVMVQVNTSKEQEKNGCEITNVCPLVQHIIANCKNLEFIGLMTIGMFG YDYSKEPNPDFLCLKECRENVSKQLDIDLKQIELSMGMSNDYEHAVELGSTNVRVGTAIF GERPKKNI |
 Top
| |