| Protein: 328776521 XP_623504.2 PREDICTED: hypothetical protein LOC551149 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.8 | 37.9 | 28.3 | 1.1943463 | 1.3392227 |
| Scape | 32.1 | 29.9 | 38 | 0.8447368 | 0.7868421 |
| Brain | |||||
| Crop | |||||
| Eye | 77.6 | 9.7 | 12.7 | 6.110236 | 0.7637795 |
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 53.5 | 46.5 | 1.1505376 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 67.6 | 32.4 | 2.0864198 | ||
| Salivary gland, thoracic | 36.2 | 31.2 | 32.5 | 1.1138462 | 0.96 |
| Sternite | 21.3 | 38.7 | 40.1 | 0.5311721 | 0.9650873 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 73.3 | 14.9 | 11.8 | 6.2118645 | 1.2627119 |
| Malpighian tubules | 37 | 21.3 | 41.8 | 0.8851675 | 0.5095694 |
| Nerve chord | 52.6 | 14.7 | 32.7 | 1.6085627 | 0.44954127 |
| Poison sac | |||||
| Sting | |||||
| Heart | 30.5 | 37.1 | 32.3 | 0.94427246 | 1.1486068 |
| Hypopharyngeal gland | 23.1 | 76.9 | 0.30039012 | ||
| Galea | 9.2 | 60.9 | 30 | 0.30666667 | 2.03 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.8 | 31.1 | 35.1 | 1.2193732 | 0.8860399 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGTITSSYSTVESKQMSNIRMTTKCRTNILVASYSEDQLAGKYIIIKFFITIEFQEAFQL FDSRGDGKIHVAQIGDALRALGQNPTESDVKKFTHQHKPDERISFEVFLPIYQAISKSRT SDTADDFIEGLRHFDKDGNGFISSAELRHLLTTLGEKLSDEEVETLLAGHEDSQGNINYE DFVRQEDELLKAVRNSESLRLTFTLHLTESTSVEWETVVWRRCLYIRVPSCLLPEGSKEG FVSLLEYAEETLRCINIIICLRKDRADRGTCRQPFFDSNENDYGGKNFSSKTFCCYGLAM LVRTFMFLGFSVLPPTHSLVPPGSDAGNLYMLYAIE |
 Top
| |