| Protein: 110757341 XP_001122230.1 PREDICTED: mitochondrial import inner membrane translocase subunit Tim8 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 39.8 | 22.3 | 37.9 | 1.0501319 | 0.5883905 |
| Brain | 67 | 33 | 2.030303 | ||
| Crop | 48.3 | 51.7 | 0.934236 | ||
| Eye | |||||
| Intestine | 31.8 | 28.3 | 39.9 | 0.7969925 | 0.70927316 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 24 | 29.3 | 46.7 | 0.51391864 | 0.627409 |
| Rectum | |||||
| Salivary gland, cerebral | 48 | 26.2 | 25.8 | 1.8604652 | 1.0155039 |
| Salivary gland, thoracic | 50.1 | 22.6 | 27.3 | 1.8351648 | 0.82783884 |
| Sternite | 31.9 | 40.3 | 27.8 | 1.147482 | 1.4496403 |
| Tergite | 47.1 | 52.9 | 0.89035916 | ||
| Ventriculus | |||||
| Thoracic muscle | 3.4 | 68.8 | 27.8 | 0.12230216 | 2.4748201 |
| Fat body | 83.9* | 16.1 | 5.21118 | ||
| Malpighian tubules | 36.5 | 33.8 | 29.7 | 1.2289562 | 1.1380471 |
| Nerve chord | 18.2 | 32.4 | 49.4 | 0.36842105 | 0.65587044 |
| Poison sac | |||||
| Sting | |||||
| Heart | 46.6 | 26.8 | 26.6 | 1.7518797 | 1.0075188 |
| Hypopharyngeal gland | 68.3 | 31.7 | 2.1545742 | ||
| Galea | 28.2 | 27.3 | 44.5 | 0.6337079 | 0.61348313 |
| Glossa | 14.2 | 31.4 | 54.5 | 0.26055047 | 0.5761468 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.3 | 41.1 | 36.7 | 0.880109 | 1.119891 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDDIMEDNKIGSGELQEFVIAEKQKALIQAQIHEFNDICWDKCIDKPGVKLDSRTETCL TNCVDRFIDVSLLITNRFAQLLQKSV |
 Top
| |