| Protein: 66547760 XP_392684.2 PREDICTED: dihydropteridine reductase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.2 | 28.3 | 30.5 | 1.3508197 | 0.92786884 |
| Scape | 27.9 | 43.4 | 28.7 | 0.9721254 | 1.5121951 |
| Brain | 54 | 46 | 1.173913 | ||
| Crop | 8* | 32 | 60 | 0.13333334 | 0.53333336 |
| Eye | 82.8 | 17.2 | 4.8139534 | ||
| Intestine | 14.3 | 54.5 | 31.1 | 0.45980707 | 1.7524116 |
| Leg, front | 38.9 | 28 | 33 | 1.1787878 | 0.8484849 |
| Leg, middle | 36.8 | 29.4 | 33.8 | 1.0887574 | 0.8698225 |
| Leg, rear | 52.2 | 17.3 | 30.5 | 1.7114754 | 0.5672131 |
| Mandibular gland | 22.4 | 37.8 | 39.8 | 0.56281406 | 0.94974875 |
| Rectum | 58.1 | 41.9 | 1.3866348 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.6 | 27 | 39.4 | 0.8527919 | 0.6852792 |
| Sternite | 42.5 | 31.2 | 26.3 | 1.6159695 | 1.1863118 |
| Tergite | 25 | 46.1 | 28.9 | 0.8650519 | 1.5951557 |
| Ventriculus | 21.6 | 46 | 32.4 | 0.6666667 | 1.4197531 |
| Thoracic muscle | |||||
| Fat body | 39.4 | 20.8 | 39.9 | 0.98746866 | 0.52130324 |
| Malpighian tubules | 38.6* | 42.6 | 18.9 | 2.0423281 | 2.2539682 |
| Nerve chord | 13.8 | 60.4 | 25.8 | 0.53488374 | 2.3410852 |
| Poison sac | |||||
| Sting | 47.4 | 52.6 | 0.9011407 | ||
| Heart | 19.4 | 35 | 45.6 | 0.42543858 | 0.76754385 |
| Hypopharyngeal gland | 67.4 | 32.6 | 2.0674846 | ||
| Galea | 26.9 | 35.8 | 37.3 | 0.7211796 | 0.9597855 |
| Glossa | 14.6 | 34.1 | 51.3 | 0.28460038 | 0.6647174 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 39.9 | 35.8 | 0.88268155 | 1.1145252 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEAILGRVFVYGGKGALGSACISKFKSKSWWVGCIDMKANEQADANIIVKSDNNWQEQEA DILQQVTNILKGNKLDAIICVAGGWAGGNAAHKDFVKNSELMWKQSVWSSVIAASIAAHH LKEGGFLSLTGAKAALAGTPGMIGYGMAKAAVHQLTKSLATKDSGFPKDSLIVSILPVTL DTPMNRKWMPNADTSKWTSLEFVADLFWKWSQNQERPTNGSLLQLITNNNKTEIIIA |
 Top
| |