| Protein: 328790282 XP_001122981.2 PREDICTED: fatty-acid amide hydrolase 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.2 | 32.9 | 40.9 | 0.6405868 | 0.804401 |
| Scape | 13.4 | 86.6 | 0.15473442 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 21.1 | 42.8 | 36.2 | 0.5828729 | 1.1823205 |
| Leg, front | 35 | 32.4 | 32.6 | 1.0736196 | 0.993865 |
| Leg, middle | 31.5 | 27.3 | 41.2 | 0.7645631 | 0.6626214 |
| Leg, rear | 50.2 | 22 | 27.9 | 1.7992831 | 0.78853047 |
| Mandibular gland | |||||
| Rectum | 3.5 | 96.5 | 0.03626943 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 42.8 | 20.7 | 36.5 | 1.1726028 | 0.5671233 |
| Sternite | 22.3 | 77.7 | 0.28700128 | ||
| Tergite | |||||
| Ventriculus | 13.4 | 86.6 | 0.15473442 | ||
| Thoracic muscle | |||||
| Fat body | 13.7 | 28.8 | 57.5 | 0.23826087 | 0.5008696 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 1.5 | 65.1 | 33.4 | 0.04491018 | 1.9491018 |
| Hypopharyngeal gland | 81.7 | 18.3 | 4.464481 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 24.8 | 34.6 | 51.7 | 0.47969052 | 0.66924566 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MCTLVERNSKTQFDILIDLIFGLYYKNDIQKVPPIKNNLILMSASELAEKIRTKKISSLE VVTAFIERAKEVNEIINAVVEDRYSDALEEAKEIDKLLQTLENTDLIKEKKPFLGVPFTT KESNEAKGMLHTMGLISRRNFRSQEDATAIHLIKNVGGILIAKTNIPELNLWTESRNNLY GQTCNPYDTTRNVGGSSGGEAAITAACGTAFSVASDIGGSIRMPAFFNGVFGFKPTAGLT PLKGIGLRQEDYPNSMAEVGPICKKAEDLIPLLKVLIQDKISLLNLNAEVDITQLNIFYQ ENSGDIRASKINYEMRTALLKVVQHFKEVNGSVTKIKIPGSEYSYRLWRFWMTQENMDFK LNITNRKYRTSAFTEISKLLTGKCELTFAAILKLIDEDLFPAEDPKWAMNVTTNMKNYLM NKLEHNGILFYPSSPYSAGYHYTAFLRPYNFGYWCLFNVLKFPVCQVPLGIDKNGLPIGV XXIAAPYNDHLCLAVARELDKVFGCWVPPS |
 Top
| |