| Protein: 58585222 NP_001011640.1 take-out-like carrier protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 60.9 | 39.1 | 1.5575447 | ||
| Scape | 95* | 5 | 19 | ||
| Brain | 24.2 | 75.8 | 0.31926122 | ||
| Crop | 12.5 | 70.3* | 17.2 | 0.7267442 | 4.087209 |
| Eye | |||||
| Intestine | 25.8 | 52.1 | 22.1 | 1.1674209 | 2.357466 |
| Leg, front | 36.5 | 29.1 | 34.4 | 1.0610465 | 0.8459302 |
| Leg, middle | 40.4 | 59.6 | 0.67785233 | ||
| Leg, rear | 25.2 | 15* | 59.8 | 0.4214047 | 0.25083613 |
| Mandibular gland | |||||
| Rectum | 6.9 | 59.5 | 33.6 | 0.20535715 | 1.7708334 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.2* | 95.3* | 4.5 | 0.044444446 | 21.177778 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 2.8 | 46.1 | 51.1 | 0.05479452 | 0.90215266 |
| Thoracic muscle | |||||
| Fat body | 81.8 | 3.5 | 14.7 | 5.5646257 | 0.23809524 |
| Malpighian tubules | 97.9* | 2.1 | 46.61905 | ||
| Nerve chord | 92.6* | 7.4 | 12.513514 | ||
| Poison sac | |||||
| Sting | 57.9 | 42.1 | 1.375297 | ||
| Heart | 20.7 | 21.8 | 57.5 | 0.36 | 0.37913042 |
| Hypopharyngeal gland | |||||
| Galea | 21.9 | 22.5 | 55.6 | 0.3938849 | 0.40467626 |
| Glossa | 32.4 | 22.6 | 45 | 0.72 | 0.50222224 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.3 | 47.2 | 34.8 | 0.95689654 | 1.3563218 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGRITIIRFFVLTTMLMMAIAVELPNNWRICDRSLPQKEYNQCIAEAVRDAVVSLAGGLK SFKILPIEPLAVDSVKIGESQGSVTLRQEYKNIKLYGLTKNLEIKNYNIDWDKCILSSES YNPQVDFVADYKIEGKVLLLPVRGAGKSNITMYDLKSHNDIYCEKYEKNGETYLRIKKHA VKFNPAKVKLRFENLFDGNKELGEQMNRFINENSELLFKELQAAYEETFSLVFTKIDNEI FNRVPFDKIFPPK |
 Top
| |