| Protein: 66509518 XP_624357.1 PREDICTED: calumenin |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 60.5 | 39.5 | 1.5316455 | ||
| Scape | 49.9 | 24.4 | 25.7 | 1.9416343 | 0.94941634 |
| Brain | |||||
| Crop | 29.3 | 44.2 | 26.5 | 1.1056603 | 1.6679245 |
| Eye | 70.3 | 29.7 | 2.3670034 | ||
| Intestine | 19.4* | 80.6 | 0.24069479 | ||
| Leg, front | |||||
| Leg, middle | 54.2 | 45.8 | 1.1834061 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 98.5* | 1.5 | 65.666664 | ||
| Salivary gland, thoracic | 10.6 | 59.5 | 29.9 | 0.35451505 | 1.9899665 |
| Sternite | 25.4 | 55.3 | 19.4 | 1.3092784 | 2.8505154 |
| Tergite | 21.9 | 55.9 | 22.1 | 0.9909502 | 2.5294118 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 42.9 | 27.8 | 29.3 | 1.4641638 | 0.94880545 |
| Malpighian tubules | 20.3 | 60.9 | 18.8 | 1.0797873 | 3.2393618 |
| Nerve chord | 63* | 18.7 | 18.3 | 3.442623 | 1.021858 |
| Poison sac | 8.5 | 91.5 | 0.09289618 | ||
| Sting | 65.5 | 34.5 | 1.8985507 | ||
| Heart | 35.5 | 36 | 28.5 | 1.245614 | 1.2631578 |
| Hypopharyngeal gland | 67.5 | 32.5 | 2.0769231 | ||
| Galea | 34.7 | 27.9 | 37.4 | 0.9278075 | 0.7459893 |
| Glossa | 14.8 | 42.9 | 42.4 | 0.3490566 | 1.0117924 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 43.8 | 34.4 | 1.119186 | 1.2732558 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQEFMLLQILIGFSFLATAIPKPENDHKPRVINKEPNSEEHYVNSQHNPAYDHEVFLGEE AKTFDQLTPEESTRRLGIIVDKIDKDNDGYVTGEELKDWILYSQRRYIRNNIEHQWKSHN PEEKEKLPWTEYLAMVYGDMDEQEAENHEKSKDNTFSYAAMLKKDRRRWTAADLDGDDAL TKEEFAAFLHVEEADHTKDIVVLETMEDIDKDGDGKISLSEYIGDVYDGAEGEEEPEWVK NEKEQFSMYRDKDGDGFLDLEEVKTWIIPADFDHAEAESRHLIFEADTDADQKLTKDEIL KKYDIFVGSQATDFGEALTRHDEF |
 Top
| |