| Protein: 66516797 XP_397567.2 PREDICTED: hypothetical protein LOC409486 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.8 | 27.7 | 39.4 | 0.8324873 | 0.70304567 |
| Scape | 40.5 | 20.9 | 38.6 | 1.0492228 | 0.5414508 |
| Brain | |||||
| Crop | 48.3 | 51.7 | 0.934236 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 53.6 | 46.4 | 1.1551725 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 5.4 | 94.6 | 0.057082452 | ||
| Rectum | |||||
| Salivary gland, cerebral | 69 | 31 | 2.2258065 | ||
| Salivary gland, thoracic | 32.1 | 37.4 | 30.4 | 1.0559211 | 1.2302631 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 24.1 | 75.9 | 0.31752306 | ||
| Thoracic muscle | |||||
| Fat body | 62.1 | 37.9 | 1.6385224 | ||
| Malpighian tubules | 36.6 | 36 | 27.4 | 1.3357664 | 1.3138686 |
| Nerve chord | 50.6 | 17.8 | 31.6 | 1.6012658 | 0.56329113 |
| Poison sac | |||||
| Sting | 53.6 | 46.4 | 1.1551725 | ||
| Heart | 38.5 | 30 | 31.6 | 1.2183545 | 0.9493671 |
| Hypopharyngeal gland | 39.1 | 60.9 | 0.64203614 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.2 | 37.5 | 46 | 0.8304348 | 0.8152174 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVSSNQPRKTKIFVGRLPENCRNDELRQLFLRFGEVTECDVMNRYGFVHMAREEDAAAAI KALHNSNFKGATINVEQSTGKSRGGGGGRRDGDRRGGPVRGGRGGRDGGRDARPGPYNDR RVLPIQLVGYDGSAAGGVATGYTDYNRGAGDFSGRGADFGTGYTDRGAYGQNVGSAAMGY TSTAPGMGGGYGPATGAVGGYGPTGTADYGRTDYSRAADFGARTDYVVGGGMTGDFNRGA PGPMDYGRTDNFGANRTVDYTARNDYDRAATGPMRNGGGAVATTGYGTGYTDVGYDESHW GYPGGPGDMMGGPGGVSQGASMAYDRRDGPPVNDMPPFNRPMSTGPSYSTGAPSYSTGPG PQADMFSRRPGSAVPSGGYPPVGGGYTEGYDRPDAYGPPRGGGRFPGPADAMPPRY |
 Top
| |