| Protein: 110762773 XP_001120097.1 PREDICTED: protein yellow |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.4 | 40.1 | 29.5 | 1.0305085 | 1.3593221 |
| Scape | 41.8 | 28.4 | 29.8 | 1.4026846 | 0.95302016 |
| Brain | 44.5 | 55.5 | 0.8018018 | ||
| Crop | 41.4 | 36.5 | 22.1 | 1.8733032 | 1.6515837 |
| Eye | 49.4 | 50.6 | 0.97628456 | ||
| Intestine | 35.2 | 32.5 | 32.3 | 1.0897833 | 1.006192 |
| Leg, front | 34.9 | 34.7 | 30.4 | 1.1480263 | 1.1414474 |
| Leg, middle | 35.4 | 34.3 | 30.3 | 1.1683168 | 1.1320132 |
| Leg, rear | 29.5 | 35.8 | 34.7 | 0.8501441 | 1.0317003 |
| Mandibular gland | 10.5 | 42.5 | 47 | 0.22340426 | 0.90425533 |
| Rectum | 34.9 | 41.8 | 23.3 | 1.4978541 | 1.7939914 |
| Salivary gland, cerebral | 25.8 | 53.2 | 21 | 1.2285714 | 2.5333333 |
| Salivary gland, thoracic | 25 | 42.7 | 32.3 | 0.7739938 | 1.3219814 |
| Sternite | 40.7 | 24.7 | 34.6 | 1.1763005 | 0.71387285 |
| Tergite | 40.1 | 14.4 | 45.6 | 0.87938595 | 0.31578946 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 77.4 | 8 | 14.6 | 5.3013697 | 0.5479452 |
| Malpighian tubules | 37.3 | 37.8 | 24.9 | 1.4979919 | 1.5180722 |
| Nerve chord | 19.1 | 55.2 | 25.7 | 0.74319065 | 2.1478598 |
| Poison sac | |||||
| Sting | 49.5 | 50.5 | 0.980198 | ||
| Heart | 19.5 | 38.6 | 41.9 | 0.46539378 | 0.92124104 |
| Hypopharyngeal gland | 65.4 | 34.6 | 1.8901734 | ||
| Galea | 38.7 | 26.1 | 35.3 | 1.0963173 | 0.7393768 |
| Glossa | 37.4 | 24 | 38.6 | 0.96891195 | 0.6217617 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.5 | 37.4 | 34.1 | 1.0117302 | 1.0967742 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIVVLLVTLVAVAKCHEPFRVVFQWNTIDVMWPSEENKEYAISHNDYVPANNFIAGIKF WKGKMYLTIPRWKDGVPVTLGVTSAKPVNHITAPKLEAFPSWEMQKIGDCSAFQMVQSME IDPIGRMWVLDSGKMSPLSLEVKTTCPPRLVILDLEKNGEVLRIYEFPANVARHGTAHLN DIVLDHEDGGMAYITDSDRNDPGIIVYSLRNNTSWKVRHDSMKAKHEAIKFMISKTPINI PVPVDGIALSPASSNDRQIYYSPLSSFHLYSIPTSVLKNNASNVDSYVKELGRKNSQTDG MMMSAKGVLYFGLLADDAVAMWDTKQSISFTTGQRVISRDHERMQWPDTFAFDEDGNFYC VTNSLQNILENRVNVSIPNYRVVRSETGVKSYQYLEDGTAPEQPEIPTSAANRISLAVTT GLTILLAFVVQ |
 Top
| |