Home List proteins by tissue Protein search Downloads Links
Protein: 66513092 XP_392478.2 PREDICTED: malate dehydrogenase mitochondrial-like isoform 1
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 26.5 44.2 29.3 0.9044369 1.5085324
Scape 23.5 35.6 40.9 0.57457215 0.8704156
Brain 31.6 32.1 36.3 0.8705234 0.88429755
Crop 25.9 32.6 41.5 0.6240964 0.7855422
Eye 28.9 38.6 32.4 0.8919753 1.191358
Intestine 32.9 30.8 36.3 0.90633607 0.8484849
Leg, front 30 36.1 33.9 0.88495576 1.0648967
Leg, middle 31.4 34.4 34.2 0.91812867 1.0058479
Leg, rear 26.5 34.8 38.8 0.6829897 0.8969072
Mandibular gland 9.4 50.5 40.1 0.23441397 1.2593516
Rectum 38.3 31.3 30.4 1.2598684 1.0296053
Salivary gland, cerebral 48.1 27 24.9 1.9317269 1.0843374
Salivary gland, thoracic 38.6 29.3 32.2 1.1987578 0.90993786
Sternite 32.3 41.6 26.1 1.2375479 1.5938697
Tergite 20.6 50.7 28.7 0.71777004 1.7665505
Ventriculus 27.6 27.7 44.7 0.61744964 0.6196868
Thoracic muscle 4.9 36.3 58.8 0.083333336 0.61734694
Fat body 39.5 40.1 20.4 1.9362745 1.9656863
Malpighian tubules 37.8 33.5 28.6 1.3216783 1.1713287
Nerve chord 23.4 39.1 37.4 0.62566847 1.0454545
Poison sac
Sting 42.9 57.1 0.7513135
Heart 45.9 22.3 31.8 1.4433962 0.7012579
Hypopharyngeal gland 89.8 10.2 8.803922
Galea 25.3 42.2 32.5 0.7784615 1.2984616
Glossa 27.6 38.3 34.2 0.80701756 1.1198831
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 29.4 38.5 34.5 0.8521739 1.115942
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MLPQYLKPILNVTQQGAKRLSTSAKCNAKVAILGASGGIGQPLSLLMKQSPLVTELSLYD
VVNTPGVAADLSHMDTPAKVKAYTGPEELKDALKGTQVVIIPAGVPRKPGMTRDDLFSTN
ASIVRDLTQAIAEASPKAFIAIISNPVNSTVPIASEVLKKAGVYDPNRVFGVTTLDIVRA
NTFIAEAKGLNPQNVSVPVIGGHSGVTIIPLISQTKPSVSFPEDKVKALTMRIQEAGTEV
VKAKAGTGSATLSMAYAGARFGFSLIKALNGERITEYCYVKSDVCDTKYFSTAVVLGKAG
IEKNLGIGNLNAYEKELLNAAIPELKKNVEKGEKFMNK

Top