| Protein: 328789442 XP_003251273.1 PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 53.7 | 46.3 | 1.1598272 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 35 | 25.9 | 39.1 | 0.89514065 | 0.6624041 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 35.6 | 29.1 | 35.3 | 1.0084985 | 0.82436264 |
| Nerve chord | 55.3 | 44.7 | 1.2371365 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 49.1 | 20.2 | 30.7 | 1.5993485 | 0.65798044 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.8 | 32.2 | 39.2 | 1.1173469 | 0.8214286 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAESDKLNIDNIIARLLEGKATHLPSLRGVRGARPGKNVQLTEGEIKGLCLKSREIFLSQ PILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLA YKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKI FCCHGGLSPDLQNMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGA EVVAKFLHKHDFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETL MCSFQILKPADKKKLTYGGLNANRPVTPPRGGGNNKSKKK |
 Top
| |