| Protein: 66515955 XP_623272.1 PREDICTED: 60S ribosomal protein L35a isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.5 | 62.5 | 0.6 | ||
| Scape | 38.5 | 34.5 | 27 | 1.425926 | 1.2777778 |
| Brain | |||||
| Crop | 40.3 | 59.7 | 0.67504185 | ||
| Eye | |||||
| Intestine | 4.8* | 50.6 | 44.5 | 0.10786517 | 1.1370786 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 74.3 | 25.7 | 2.8910506 | ||
| Salivary gland, cerebral | 89.5 | 10.5 | 8.523809 | ||
| Salivary gland, thoracic | 39.5 | 10.1 | 50.4 | 0.78373015 | 0.20039682 |
| Sternite | 26.3 | 39 | 34.7 | 0.7579251 | 1.1239192 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 24 | 37.2 | 38.9 | 0.6169666 | 0.9562982 |
| Malpighian tubules | 26.1 | 35.6 | 38.3 | 0.68146217 | 0.9295039 |
| Nerve chord | 43 | 9.5 | 47.5 | 0.9052632 | 0.2 |
| Poison sac | |||||
| Sting | 42.8 | 57.2 | 0.74825174 | ||
| Heart | 20.5 | 48.3 | 31.2 | 0.65705127 | 1.5480769 |
| Hypopharyngeal gland | 8.3 | 91.7 | 0.090512544 | ||
| Galea | 38.2 | 27.1 | 34.7 | 1.1008645 | 0.7809798 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.5 | 35 | 43.6 | 0.8142202 | 0.8027523 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADTPAEPKSKTKATKKPKEKPVEPPPLKKRPFKRHGRLYAKAIFTGYKRGLRNQHEHTA LLKVEGARDKQDSNFYVGKRCVYVYKAKNKTPVPGKKSRKTKVRAIWGKVTRPHGTSGSV RAKFKKNLPAKAMGHRIRIMLYPSRI |
 Top
| |