| Protein: 110760871 XP_623512.2 PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.5 | 28 | 38.5 | 0.8701299 | 0.72727275 |
| Scape | 22.7 | 37.4 | 39.9 | 0.5689223 | 0.93734336 |
| Brain | 42 | 24.6 | 33.4 | 1.257485 | 0.73652697 |
| Crop | 29.1 | 29.6 | 41.3 | 0.7046005 | 0.71670705 |
| Eye | 8 | 67.8 | 24.2 | 0.3305785 | 2.801653 |
| Intestine | 34.9 | 26.5 | 38.6 | 0.90414506 | 0.6865285 |
| Leg, front | 32.5 | 40.7 | 26.8 | 1.2126865 | 1.5186567 |
| Leg, middle | 29.2 | 42.9 | 27.8 | 1.0503597 | 1.5431654 |
| Leg, rear | 21.1 | 41.2 | 37.8 | 0.5582011 | 1.0899471 |
| Mandibular gland | 4.3 | 63 | 32.8 | 0.13109756 | 1.9207317 |
| Rectum | 52.8 | 47.2 | 1.1186441 | ||
| Salivary gland, cerebral | 8.4 | 8.2 | 83.5 | 0.1005988 | 0.09820359 |
| Salivary gland, thoracic | 39.7 | 25.2 | 35.2 | 1.1278409 | 0.71590906 |
| Sternite | 44.7 | 43.9 | 11.3 | 3.9557521 | 3.8849556 |
| Tergite | 66.3 | 23.2 | 10.4 | 6.375 | 2.2307692 |
| Ventriculus | |||||
| Thoracic muscle | 13.4 | 21.6* | 64.9 | 0.20647149 | 0.33281973 |
| Fat body | 54 | 36.4 | 9.6 | 5.625 | 3.7916667 |
| Malpighian tubules | |||||
| Nerve chord | 21 | 47 | 32 | 0.65625 | 1.46875 |
| Poison sac | |||||
| Sting | 65.7 | 34.3 | 1.9154519 | ||
| Heart | 38.3 | 25.1 | 36.5 | 1.0493151 | 0.68767124 |
| Hypopharyngeal gland | 82.8 | 17.2 | 4.8139534 | ||
| Galea | 24.7 | 45.2 | 30.2 | 0.8178808 | 1.4966887 |
| Glossa | 11.3 | 60.4 | 28.3 | 0.39929327 | 2.1342757 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.9 | 40.8 | 34 | 0.85 | 1.2 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLNLCRQALIVNNQKVSTRCLGTIIPVSNTIEFPLENEPVLSYKKGSPERAELEKVLNKM SNECEEVPLVIGNEEIKTDLCKYQVMPHNHKVKIAKYYWATADLVKKAIDVSVKAQREWE KCPFEKRLEIWLRAADLMATKYRQQLNAATMLGQSKTVIQAEIDSAAELIDFFRMHGYFA KEAMKYQPISPNKETLNSMRYRGMDGFVAAVSPFNFTAIGGNLSYTPALMGNAVLWKPSD TALLSNWWIFKICKEAGVPPGVVNFIPCEGPVFGDTITASPYLSGINFTGSVPTFNRLWI QVGKNLGKYKNYPKLIGECGGKNYHFVHASADVESVVNGTIKSAFEFNGQKCSACSRMYV PESLWPQIKEGLLSIRETLKIGDVRDFTVFTGAVIDAIAFKRITSYIEHAKKSSNLEIIG GGEYDNSIGYFINPTIVITKNPKDKIMTEEIFGPVLTIYVYKDSNLDETMKLVESSTPYA LTGSIFSQDEKWARRALEEFKYTAGNFYVNDKSTGSVVGQQPFGGSRMSGTNDKAGGPHY ALRWASPQSIKETFVPLREHDYAYMRS |
 Top
| |