| Protein: 66556512 XP_623105.1 PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 32.4 | 35.4 | 32.2 | 1.0062112 | 1.0993788 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 32.7 | 33.1 | 34.2 | 0.95614034 | 0.96783626 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 29.6 | 41.7 | 28.8 | 1.0277778 | 1.4479166 |
| Nerve chord | 31.1 | 29 | 39.9 | 0.7794486 | 0.7268171 |
| Poison sac | |||||
| Sting | |||||
| Heart | 26.5 | 41.7 | 31.9 | 0.830721 | 1.3072101 |
| Hypopharyngeal gland | 58.8 | 41.2 | 1.4271845 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.5 | 39.9 | 34.7 | 0.8789625 | 1.1498559 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEEKASLKELDQWIEQLNNCQQLTESQVKSLCEKAKEILAKESNVQEVKCPVTVCGDVHG QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES RQITQVYGFYDECLRKYGNANVWKFFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHSNGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAPRRGEPHV TRRTPDYFL |
 Top
| |