| Protein: 328777082 XP_393371.3 PREDICTED: myosin regulatory light chain 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 51.3 | 48.7 | 1.0533881 | ||
| Scape | 32.9 | 51.8* | 15.4 | 2.1363637 | 3.3636363 |
| Brain | |||||
| Crop | 41 | 8.8 | 50.2 | 0.81673306 | 0.17529881 |
| Eye | 5.5 | 39.1 | 55.4 | 0.09927798 | 0.70577615 |
| Intestine | 63.8 | 36.2 | 1.7624309 | ||
| Leg, front | 52.4* | 25.1 | 22.4 | 2.3392856 | 1.1205357 |
| Leg, middle | 43.6 | 29.9 | 26.5 | 1.645283 | 1.1283019 |
| Leg, rear | 24.9 | 40.8 | 34.3 | 0.7259475 | 1.1895044 |
| Mandibular gland | 51.4 | 0.3* | 48.3 | 1.0641822 | 0.00621118 |
| Rectum | 60.3 | 39.7 | 1.5188917 | ||
| Salivary gland, cerebral | 3.9 | 56.7 | 39.4 | 0.09898477 | 1.4390863 |
| Salivary gland, thoracic | 85.6* | 4.2 | 10.2 | 8.392157 | 0.4117647 |
| Sternite | 41.6 | 23.7 | 34.7 | 1.1988473 | 0.6829971 |
| Tergite | 31.8 | 28.6 | 39.6 | 0.8030303 | 0.7222222 |
| Ventriculus | |||||
| Thoracic muscle | 1.1 | 97.7* | 1.2 | 0.9166667 | 81.416664 |
| Fat body | 69.5* | 28.5* | 2 | 34.75 | 14.25 |
| Malpighian tubules | |||||
| Nerve chord | 81.4* | 4.8 | 13.8 | 5.8985505 | 0.3478261 |
| Poison sac | 49.4 | 50.6 | 0.97628456 | ||
| Sting | 31.3 | 68.7 | 0.45560408 | ||
| Heart | 16.2 | 65.8* | 18 | 0.9 | 3.6555555 |
| Hypopharyngeal gland | 99.7* | 0.3 | 332.33334 | ||
| Galea | 29.1 | 35.6 | 35.3 | 0.82436264 | 1.0084985 |
| Glossa | 34.7 | 32.5 | 32.9 | 1.0547112 | 0.98784196 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 40.4 | 31.5 | 1.2063493 | 1.2825397 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDCYLVMKTSQGPSGLFTVLTDLSANCFSRNVERVAILRWLALNMLVRSDHLVPSSYKP TVDMADKEKKKKTKKKEEAAPAPPPPEPEPEPEKPPTPAPSTPKESGSTRASSRGSRKAK RAGSSVFSMFTQKQVAEFKEAFQLMDQDKDGIIGKNDLRATFDNVGRLVTDKELDDMLNE APAPINFTQLLNLFASRMSGSGQDDDETVIAAFSTFDVNGKIDGERLRHALMTYGDKFTA KEVNDAYDNMYIDDKGFIDTQSLIAMLTGQEDEDEE |
 Top
| |