| Protein: 66505254 XP_625258.1 PREDICTED: hypothetical protein LOC551596 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 32.8 | 36.5 | 30.7 | 1.068404 | 1.188925 |
| Brain | |||||
| Crop | 63.7 | 36.3 | 1.754821 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 79.2* | 20.8 | 3.8076923 | ||
| Leg, middle | 80.7* | 19.3 | 4.1813474 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 54.9 | 45.1 | 1.2172949 | ||
| Salivary gland, thoracic | 20.6 | 32 | 47.4 | 0.43459916 | 0.6751055 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 40.3 | 44 | 15.7 | 2.566879 | 2.8025477 |
| Nerve chord | 29.7 | 53.3 | 17 | 1.7470589 | 3.1352942 |
| Poison sac | |||||
| Sting | 72.8 | 27.2 | 2.6764705 | ||
| Heart | 68* | 15.9 | 16.1 | 4.2236023 | 0.9875776 |
| Hypopharyngeal gland | 9 | 91 | 0.0989011 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.1 | 48.7 | 33.3 | 1.2342342 | 1.4624624 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADTETKDTKVATTPEKKVVEEEKKTVQEVDEDSKTSENGDAKETKENGSNEEKESENKE VESAENGDSTDASVDSCCIKRKSITLSETTEDTATDGASPEKKKKLDEKCAETETNGDAE ATA |
 Top
| |