| Protein: 66525633 XP_392085.2 PREDICTED: sideroflexin-3-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 13.7 | 86.3 | 0.15874855 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 87.5* | 12.5 | 7 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 9.3 | 68.5 | 22.3 | 0.41704035 | 3.071749 |
| Sternite | 13.2 | 22.5 | 64.3 | 0.20528771 | 0.34992224 |
| Tergite | 15.2 | 84.8 | 0.17924528 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 3.6* | 20.4 | 76 | 0.047368422 | 0.26842105 |
| Malpighian tubules | |||||
| Nerve chord | 30.4 | 35.7 | 34 | 0.89411765 | 1.05 |
| Poison sac | |||||
| Sting | |||||
| Heart | 1.2* | 37.7 | 61 | 0.019672131 | 0.6180328 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 22.9 | 33.1 | 55.2 | 0.41485506 | 0.5996377 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKERIDIEKPYWDQSTYKGRALHFLAVTNPLNLFATGKQLEHARDVVTKYRKGDSLAEL KITEDELWRCKYLYDSAFHPDTGEKMFLIGRMSAQVPMNMMITGCMLTFYKTTTHVMFWQ WVNQSFNAIVNYTNRSGSSPIPTQTILQSYGIATGGAVITALSLNRLFRNAPPMVCRLVP FAAVAAANCVNIPFMRMLELQNGIELQTEKGVKIGNSKRAARRAIAAVTLSRVLMAVPSM TMAPIIMNVIERRKLLQEAKWAVVPIQVLICGICLTFATPLCCALFEQRVAMSVDDLEPE VREQILSKYPNLQTVYYNKGL |
 Top
| |