| Protein: 66553455 XP_394852.2 PREDICTED: prostaglandin reductase 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.7 | 25.3 | 37 | 1.0189189 | 0.68378377 |
| Scape | 26.1 | 53.4 | 20.5 | 1.2731707 | 2.604878 |
| Brain | 73* | 27 | 2.7037036 | ||
| Crop | 40.6 | 16.1 | 43.3 | 0.93764436 | 0.37182447 |
| Eye | |||||
| Intestine | 35.1 | 38.5 | 26.4 | 1.3295455 | 1.4583334 |
| Leg, front | 50.8 | 49.2 | 1.0325203 | ||
| Leg, middle | |||||
| Leg, rear | 66 | 11.8 | 22.1 | 2.9864254 | 0.5339367 |
| Mandibular gland | 2.9 | 87.8* | 9.3 | 0.31182796 | 9.44086 |
| Rectum | 57.1 | 42.9 | 1.3310024 | ||
| Salivary gland, cerebral | 84.3 | 15.7 | 5.3694267 | ||
| Salivary gland, thoracic | 17.4 | 54.5 | 28.1 | 0.6192171 | 1.9395018 |
| Sternite | 22.4 | 42 | 35.6 | 0.6292135 | 1.1797752 |
| Tergite | |||||
| Ventriculus | 20.3 | 49.6 | 30.2 | 0.6721854 | 1.642384 |
| Thoracic muscle | |||||
| Fat body | 40.6 | 11 | 48.4 | 0.838843 | 0.22727273 |
| Malpighian tubules | 41.9 | 35.2 | 22.9 | 1.8296943 | 1.537118 |
| Nerve chord | 28.8 | 53.5 | 17.7 | 1.6271186 | 3.022599 |
| Poison sac | |||||
| Sting | 31.1 | 68.9 | 0.45137882 | ||
| Heart | 30.7 | 34.6 | 34.7 | 0.8847262 | 0.9971182 |
| Hypopharyngeal gland | |||||
| Galea | 46.7 | 53.3 | 0.8761726 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37 | 42.2 | 33.3 | 1.1111112 | 1.2672672 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIKARKFIVLKHFNGKPKKSDLQLIEEELPSLQNGEFLIEAEYLSLDPYMRVYMLRYPIG STMIGSQVGKIIESKNPNFPVGKKIIADVGWRSHTIINPFRCNVEYEFRKPRLLPDIQDL PMSLYLGVLGMPGNTAYFGLLEICKPKKGETLVISGAGGAVGSHVGQIGKILGLTVVGIA GSDEKCKWLVKELGFDHAVNYKEGNLDVALRKAVPKGIDCYFDNVGGDISSIVMYQMKLN GRVAVCGSISSYHADASSLPKATILQPTMVFNELKVEGFLVSRWDNRWNEGIEKNLQWVR EKKIRYRETVVKGFDNMFDAFVDMLEGKNIGKAIVQA |
 Top
| |