| Protein: 66517659 XP_625100.1 PREDICTED: glyoxalase domain-containing protein 4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.9 | 36 | 31.2 | 1.0544872 | 1.1538461 |
| Scape | 25.9 | 39.2 | 34.9 | 0.7421203 | 1.1232091 |
| Brain | 0.4* | 37.2 | 62.4 | 0.006410256 | 0.59615386 |
| Crop | 48.2 | 51.8 | 0.93050194 | ||
| Eye | |||||
| Intestine | 32.1 | 39.2 | 28.7 | 1.1184669 | 1.3658537 |
| Leg, front | 30.6 | 41.3 | 28.1 | 1.0889679 | 1.4697509 |
| Leg, middle | 31.7 | 38.1 | 30.1 | 1.0531561 | 1.2657807 |
| Leg, rear | 39.4 | 32.4 | 28.3 | 1.3922261 | 1.1448764 |
| Mandibular gland | 35.6 | 64.4 | 0.55279505 | ||
| Rectum | 18 | 82 | 0.2195122 | ||
| Salivary gland, cerebral | 52.2 | 47.8 | 1.0920502 | ||
| Salivary gland, thoracic | 39.3 | 23.4 | 37.3 | 1.0536193 | 0.62734586 |
| Sternite | |||||
| Tergite | 62.2 | 37.8 | 1.6455027 | ||
| Ventriculus | 39.6 | 34.5 | 25.9 | 1.5289575 | 1.3320464 |
| Thoracic muscle | |||||
| Fat body | 44.7 | 18.3 | 37 | 1.2081081 | 0.4945946 |
| Malpighian tubules | 27.1 | 43.5 | 29.4 | 0.9217687 | 1.4795918 |
| Nerve chord | 21 | 52.3 | 26.7 | 0.78651685 | 1.9588015 |
| Poison sac | |||||
| Sting | 56.4 | 43.6 | 1.293578 | ||
| Heart | 21.4 | 36.6 | 42.1 | 0.50831354 | 0.86935866 |
| Hypopharyngeal gland | 55.6 | 44.4 | 1.2522522 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.7 | 40.8 | 40.7 | 0.75429976 | 1.002457 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVTGRALHFVFKIPDRKLTIKFYREILGMKVLRHEEFAEGCEAACNGPYGNRWSKTMIGY GTEDTHFVIELTYNYGIKEYKMGNDFNGITIRSKEALQRAHSDGWPIKEENGIFVLQAPG GYKYYVIDESQPKNKDPIEKVTLFSSNLQKTIAYWKNILELKIFNQTEKSVLLGYDEDQA KIEFIDIGTEINHAAAYGRIAFSIPYAEQPEIQKKIKDNGYEILTDLITLDTPGKSSVRV IILADPDGHEICFVDDEAFRQLSIPDYASEAVLNRYIAKEK |
 Top
| |