| Protein: 110748994 XP_001120149.1 PREDICTED: arrestin domain-containing protein 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.3 | 59.7 | 0.67504185 | ||
| Scape | 41 | 21.1 | 37.9 | 1.0817941 | 0.55672824 |
| Brain | |||||
| Crop | 32.9 | 34 | 33.1 | 0.9939577 | 1.0271903 |
| Eye | |||||
| Intestine | 45.8 | 54.2 | 0.84501845 | ||
| Leg, front | |||||
| Leg, middle | 54.4 | 45.6 | 1.1929824 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 23.7 | 30.9 | 45.4 | 0.5220264 | 0.68061674 |
| Sternite | 81.8 | 18.2 | 4.4945054 | ||
| Tergite | 88 | 12 | 7.3333335 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.6 | 17.9 | 54.5 | 0.50642204 | 0.32844037 |
| Malpighian tubules | 42.7 | 57.3 | 0.7452007 | ||
| Nerve chord | 11.8 | 58.7 | 29.4 | 0.40136054 | 1.9965986 |
| Poison sac | |||||
| Sting | |||||
| Heart | 2 | 50.5 | 47.4 | 0.042194095 | 1.0654008 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 40.5 | 59.5 | 0.6806723 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.3 | 38 | 42.6 | 0.9460094 | 0.8920188 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGLKDFRIIYDNHWNTYYPGQTVSGNIIVVLDSTKKIRGISVKVKGVANTCWTTDKQDMD ERGQYRDGTQTVSAHEEYFETKYYLVGSASGGEIEIQSGEHKFPFQCVLPTNLPSSFESD FGHVRYTVKATLDRPWKFDQEVKSPFTVVSPLDLNQESRASEKIEEEMSKTFCCLCCGTP PLTVNYSLPVRGYVPGQSMPIKVNVENHSGVTVETVKLILCKMVTFRATTPTTDTKTEEI VIAEVGKGPIEGGGIADYEQKLDIPPLPPSNLTNCGIIDLEYNLKVVACVSGWYYRNLWQ NTLIFVGTVPLVNYQTPSAPPMEEYPSEIGWTRSGIPSSDGAATNLYPNLPPPSYEESTN SARSLWERGESEHIFGISNHFSPKYPVFNFAAV |
 Top
| |