| Protein: 328779079 XP_003249587.1 PREDICTED: fumarylacetoacetate hydrolase domain-containing protein 2A-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.3 | 22.9 | 38.7 | 0.9896641 | 0.59173125 |
| Scape | 32.1 | 28.3 | 39.6 | 0.81060606 | 0.71464646 |
| Brain | 27 | 49.3 | 23.7 | 1.1392405 | 2.0801687 |
| Crop | 26.2 | 41.9 | 31.9 | 0.8213166 | 1.3134797 |
| Eye | |||||
| Intestine | 38.3 | 24.1 | 37.6 | 1.018617 | 0.6409575 |
| Leg, front | 26.9 | 37.6 | 35.4 | 0.759887 | 1.0621469 |
| Leg, middle | 29.7 | 35.7 | 34.6 | 0.8583815 | 1.0317919 |
| Leg, rear | 42.5 | 26.4 | 31.2 | 1.3621795 | 0.84615386 |
| Mandibular gland | 4.7 | 65.1 | 30.2 | 0.15562914 | 2.1556292 |
| Rectum | 25.2 | 47.5 | 27.2 | 0.9264706 | 1.7463236 |
| Salivary gland, cerebral | 76.3 | 9.8 | 13.9 | 5.4892087 | 0.705036 |
| Salivary gland, thoracic | 23.7 | 47.5 | 28.8 | 0.8229167 | 1.6493056 |
| Sternite | 34.8 | 45.1 | 20.1 | 1.7313433 | 2.243781 |
| Tergite | 17.8 | 51.8 | 30.4 | 0.5855263 | 1.7039474 |
| Ventriculus | 39.3 | 26.1 | 34.6 | 1.1358382 | 0.7543353 |
| Thoracic muscle | 4.7 | 46.5 | 48.8 | 0.09631147 | 0.9528689 |
| Fat body | 26.2 | 34 | 39.8 | 0.65829146 | 0.85427135 |
| Malpighian tubules | 34.1 | 31.6 | 34.2 | 0.99707603 | 0.9239766 |
| Nerve chord | 26.8 | 42 | 31.3 | 0.85623 | 1.341853 |
| Poison sac | |||||
| Sting | 44.7 | 55.3 | 0.80831826 | ||
| Heart | 26.5 | 39 | 34.6 | 0.76589596 | 1.1271676 |
| Hypopharyngeal gland | 92.4 | 7.6 | 12.157895 | ||
| Galea | 35.7 | 31 | 33.3 | 1.072072 | 0.9309309 |
| Glossa | 30 | 20.2 | 49.8 | 0.60240966 | 0.40562248 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.3 | 39.2 | 33 | 0.91818184 | 1.1878788 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPYRGKLRLLSRACFTFRNSCAEKSNTHFATSIPGRNFSTNRAVNMRFVQFTGKNGGPQH LGVQLVQGGDIIAVSAVDSRIPNTLKKFLEGGDDLLKKAKREDEVNVLTIIERIVAEGRS VIPEVEVNFLAPVTRMDKLACVGLNYIGHCKEQGVSPPESPVIFSKFASNIIGPRDNIML PPISDKVDWEAELAIVIGKKCKALNNNEGEDYIFGYTIAQDITARDWQKSKRNGGQFLLG KAMDTFCPLGPAVVTKEAISDINNLTVKTWVNGNIKQDGNTSELIFKPHEIVAYISQFMT LLPGDVILTGTPSGVGFTRKPPEYLQRGDVLETEIQGLGRLRNKVL |
 Top
| |