| Protein: 66503826 XP_392190.2 PREDICTED: inositol oxygenase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 95* | 5 | 19 | ||
| Leg, rear | 70.5 | 14 | 15.5 | 4.548387 | 0.9032258 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 3.9* | 56.5 | 39.6 | 0.09848485 | 1.4267677 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 14.3 | 34.1 | 51.7 | 0.27659574 | 0.65957445 |
| Malpighian tubules | |||||
| Nerve chord | 82.3* | 17.7 | 4.6497173 | ||
| Poison sac | |||||
| Sting | 40.3 | 59.7 | 0.67504185 | ||
| Heart | 0.5* | 62.7 | 36.9 | 0.013550136 | 1.699187 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 22.3 | 55 | 32.3 | 0.69040245 | 1.7027863 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTQTLLQPRQARILDPSDKYRPEPVYAGKLKREFRDYSEDRNDPVKERVRKTYQKMHSN QTVDFVRSRMKEWLRFDKFKMTVKEALTKLNNLVDESDPDTDLPNIVHAFQTAELIRKEH PDLDWFHLTGLIHDLGKVMAFFGEPQWAVVGDTFPVGCAWADSIVYRDTSFEDNPDGKDS RYNTKYGMYEPKCGIENLLMSWGHDEYLYRVLVHNNCKLPEQALAMIRYHSFYPWHAGGD YMHFCTSKDMETLKWIVEFNKYDLYTKNNEVPDIEKLWPYYEKLIDKYVPGVLEW |
 Top
| |