![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66525117 XP_625185.1 PREDICTED: prefoldin subunit 6-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 63.3 | 36.7 | 1.7247957 | ||
| Scape | 42.5 | 16 | 41.5 | 1.0240964 | 0.38554215 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 4 | 0.1* | 95.9 | 0.041710116 | 0.001042753 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.1 | 12 | 43.9 | 1.0045558 | 0.2733485 |
| Sternite | 72.3 | 13.8 | 13.9 | 5.201439 | 0.9928058 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 54 | 46 | 1.173913 | ||
| Nerve chord | 25.3 | 23.9 | 50.8 | 0.4980315 | 0.47047246 |
| Poison sac | |||||
| Sting | |||||
| Heart | 69.9 | 30.1 | 2.3222592 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.6 | 21.5 | 44.8 | 0.99553573 | 0.4799107 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTNMTEEIQKNLKTELDKYKQVQKDFHKALSQRQQLDGQLNENIAVKKELDLLKSEDDVF KLIGPVLIKQDVEEAKQNVAKRMEYISSELKRVEELITTLDKKQDTHRETLEKYQQMFQQ AQIKASFSQPKA |
|
| |